(data stored in ACNUC7421 zone)

EMBL: CP000270.PE523

CP000270.PE523       Location/Qualifiers
FT   CDS_pept        589351..590610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3938"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3938"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29061"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C8"
FT                   /protein_id="ABE29061.1"
FT                   /translation="MLANCFDSGTSGGDAPVRYLLGNKDHKGSERSVKPKLFRGDPEST
FT                   KDLIDSINNKQKYTSGVLAFRENEVPSVKQMHQICDEFERYMFGGLSKDRVNILWVLHN
FT                   DKGRPELHFVVPKIDLKSGKQLNISPPGKQNQDYYRLFGAYINDKFGWEQVSPKKKWDL
FT                   KAAEYKSETVPALYKRALCKQINNNYETGMFKDRNDLIKWLEQNKIQVLKQADDFITIG
FT                   VGGNKLRMYGEIFKQNPDMSVGKPYVFNQHEKNRLEHYRVERVAYFDKRFNTPPKPRFT
FT                   ASPQGKTTVKPQVFQTVADRIKEREVASMVQNMASIGGDVADVMPKEQKPSSGVSSGGG
FT                   SSGGADTSLQKVALSLRRNDILRQLIDATPSQVAELQNELTNIDIALGRLKLQEMEEAG
FT                   REMDKLYELYKKPQIDEAPT"
     atgctagcga actgttttga ttctggaacc agtggaggtg atgcacctgt tcgatatctt        60
     ttaggcaata aagaccataa aggaagcgaa cgaagtgtta agccaaaatt atttcgaggc       120
     gatccagaat ccacgaaaga cttgatagat agtataaata ataaacaaaa atatacttca       180
     ggagtccttg catttcgtga aaatgaagtc ccttctgtca aacaaatgca ccaaatttgt       240
     gacgagtttg agcgctatat gtttggtggg ttaagtaaag atagagttaa tattttatgg       300
     gtgcttcata atgataaggg tcgtcctgaa ttgcattttg ttgtgccaaa aatagaccta       360
     aaatcgggta agcaactaaa catttctcca cctggtaagc aaaatcaaga ctactatcga       420
     ttgtttggtg cttacattaa tgacaagttt ggatgggagc aagttagtcc aaaaaagaag       480
     tgggatttga aagctgctga gtataaaagt gaaactgttc cagctttata caaaagagca       540
     ctttgcaagc aaatcaacaa taattatgaa acagggatgt ttaaggatag aaatgatttg       600
     atcaaatggc ttgagcaaaa taaaattcag gttctaaagc aagctgatga cttcataaca       660
     attggagtgg gtggcaataa actacgcatg tatggggaaa tatttaagca aaatccagat       720
     atgtcagtag ggaaacccta tgtgttcaat caacatgaaa aaaacagatt ggagcattat       780
     agagttgagc gcgtagctta ctttgataag cgttttaata ctcccccaaa acctagattt       840
     acagcatctc cacaaggcaa aacaactgta aagcctcaag ttttccagac tgtagccgat       900
     agaattaagg aaagagaggt cgctagcatg gttcaaaaca tggctagcat tgggggtgat       960
     gtagctgatg tgatgccaaa agagcaaaag ccatcatctg gcgtgtcttc tggtgggggt      1020
     tcttctggtg gggctgatac ttcacttcaa aaagtagcgc tttctttaag aagaaacgat      1080
     attttgaggc agttaattga tgcaacgcct tcccaagtgg ctgaattgca aaatgagctt      1140
     actaatatag atattgcttt gggacgcttg aaattgcagg aaatggaaga ggctgggcgt      1200
     gaaatggata aactttatga gttatataaa aagcctcaga tagatgaggc acctacttaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page