(data stored in ACNUC7421 zone)

EMBL: CP000270.PE524

CP000270.PE524       Location/Qualifiers
FT   CDS_pept        591123..591590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3937"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3937"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29062"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C7"
FT                   /protein_id="ABE29062.1"
FT                   /translation="MGNRMAEDKQLGAQLDELLKKVASGKATPTEKIKLSTLLNESAKV
FT                   EAQQEKQEKIDKVLALIDELELSRSEVAEALNGPAEVLIRYVDDTGQVHERYDGETATN
FT                   KWLKALKEAGTHNFAQAKELIVAKSADGKAKATKTLDRLYHPEKYAKPAKA"
     ttggggaaca ggatggctga agataagcaa cttggtgcac agcttgatga gttgttgaaa        60
     aaagtggcat caggtaaagc aacacccaca gaaaaaatta agctctctac acttttgaac       120
     gaaagtgcaa aagttgaggc tcaacaagaa aagcaagaaa agattgataa agtgttggcg       180
     ttgattgatg agcttgaatt gtctcgtagc gaagtagcag aagctcttaa tggtcctgct       240
     gaagtgctca ttcgttatgt tgatgacact gggcaagtgc atgaacgtta tgatggggaa       300
     acagctacca ataagtggct taaggcttta aaggaagctg gcacccacaa ttttgctcaa       360
     gccaaagaac ttattgtggc taaaagtgca gatgggaaag ccaaggcaac caaaacactt       420
     gaccgcctgt accacccgga gaagtacgca aaacctgcca aagcgtaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page