(data stored in ACNUC7421 zone)

EMBL: CP000270.PE528

CP000270.PE528       Location/Qualifiers
FT   CDS_pept        596249..596920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3933"
FT                   /product="Putative DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29066"
FT                   /db_xref="GOA:Q145C3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C3"
FT                   /protein_id="ABE29066.1"
FT                   /translation="MDTLLHFVNLVLHIDKFLGDFIHVYGAWVYAVLFLIVFCETGLVV
FT                   LPFLPGDSLLFIGGAFCATGEMNIGLLIVLLLVAAISGNTVNYMIGRAIGPRVFNSHIP
FT                   FLERFLDRSALQKTHNFYEKHGGKTIVLARFIPVVRTFAPFVAGASEMTVSRFQLFNFV
FT                   GALFWVLLLTLLGYFFGNIPFIRQYLNVIVLVGIGAAVVPVVLGALWKMMRKNASSAGS
FT                   R"
     ttggacacgt tgctacattt cgtcaacctt gtcttgcaca tcgacaagtt cctcggagac        60
     tttattcatg tgtacggcgc gtgggtctac gcggtgctgt tcctgatcgt gttctgcgaa       120
     accgggctgg tggtgctgcc gtttctgccg ggcgattcgc tgctgttcat cggcggcgcg       180
     ttttgcgcga ccggcgaaat gaatattggt ttgctgatcg tgttgctgct cgtggcggcc       240
     atcagcggca ataccgtcaa ttacatgatc gggcgagcca tcggaccgcg ggtgttcaat       300
     tcgcacattc cttttctcga acgctttctc gatcgcagcg cgctgcagaa gacccacaac       360
     ttctatgaga agcatggggg caaaaccatc gtgctggcgc gtttcatccc ggtggtgcgg       420
     acctttgcgc cgttcgttgc gggtgcatcc gaaatgaccg tgagccggtt ccagttgttc       480
     aactttgtcg gcgcgctgtt ctgggtgctg ctgctgacgt tgctcggtta tttcttcggc       540
     aacattccgt ttatccgcca gtatctgaac gtgatcgtgc tggtgggtat cggcgcagcg       600
     gtggtgccgg tcgtgctcgg cgcgttgtgg aagatgatgc gcaagaacgc ctcgagcgcg       660
     ggcagccgct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page