(data stored in ACNUC7421 zone)

EMBL: CP000270.PE535

CP000270.PE535       Location/Qualifiers
FT   CDS_pept        complement(605011..606102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3924"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29073"
FT                   /db_xref="GOA:Q145B6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B6"
FT                   /protein_id="ABE29073.1"
FT                   /translation="MREAPIHTEESFRLLVEAIDDYAIFMLDASGNVVNWNTGARKMKG
FT                   YEVDEIIGRHFSVFYTPEDVAAGQPGLLLAAAVAQGRVVSEGWRVRKDGSKFWANVVIT
FT                   TVRTPTGELRGFAKVTQDLTERKRLEEFEQLRALAAHIQAAREEEQIRIARELHDDIGQ
FT                   QLTALKMALAGLDSIVRDQEAGAARTAPHIADMHQLIDATVASLRRIAAGLRPVMLETL
FT                   GLIPTLEWLIDDFMQRYDIAVEARIEADDMKLSEAADEGLFHIVQEALTNVARHAHADR
FT                   VTIDLARDGRTCVLRVTDDGQGMTPAAPSRPTSFGLLGMRERVHHLNGTMSIDSAPGRG
FT                   FRLTLIFPLDAVERKPSSPEGAA"
     atgcgcgaag ctcccattca caccgaggag agcttccgcc tgctagtcga agcaatcgac        60
     gactacgcaa tcttcatgct ggacgcatca ggcaacgtcg tgaactggaa caccggcgca       120
     cggaagatga aagggtatga ggtcgatgaa atcatcggcc gccacttctc ggtcttttac       180
     acgcccgagg acgttgcagc aggccagccc ggtcttctgc tcgcggcagc ggtcgcgcaa       240
     ggcagagtgg tgagcgaggg ctggcgcgtt cgcaaggacg gttcgaaatt ctgggcgaac       300
     gttgtcatca caaccgtccg cacccctacc ggcgagctcc gcggttttgc aaaggtgacg       360
     caggacctga ccgaacgaaa acggctggaa gaattcgaac aactcagagc gttagccgcg       420
     cacattcagg ccgctcgcga ggaagagcag atccgcatcg cccgcgaact tcacgatgac       480
     ataggccagc aactcaccgc gctcaagatg gcgcttgcgg gtctcgacag catcgttcgc       540
     gaccaggagg caggcgccgc acgcaccgcg cctcacattg cggacatgca tcaactgatc       600
     gacgcgacgg tcgcctcgct acggcgaatc gcagccggat tgcgtcccgt catgctggag       660
     acgctggggc tcatcccgac actcgaatgg ctcatcgacg atttcatgca gcggtacgac       720
     attgccgtcg aggcacggat cgaggccgat gacatgaagc tgagcgaagc ggctgacgaa       780
     ggcctgttcc atatcgtgca ggaagcactg accaacgtgg cccggcatgc gcacgccgac       840
     cgggtgacga tcgatctggc gcgcgacggc cgcacctgtg tattgcgcgt tacggacgac       900
     gggcagggaa tgacgccggc ggcgccttcg cgcccgacct ctttcggcct gctgggcatg       960
     cgtgagcgag ttcatcacct gaatggcacg atgtcgatcg acagcgcgcc cggccgcggt      1020
     tttcgtctta ccctcatctt tccactggac gccgtcgagc gaaagccctc gagcccggaa      1080
     ggagccgcgt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page