(data stored in ACNUC7421 zone)

EMBL: CP000270.PE537

CP000270.PE537       Location/Qualifiers
FT   CDS_pept        complement(606847..607596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3922"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29075"
FT                   /db_xref="GOA:Q145B4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B4"
FT                   /protein_id="ABE29075.1"
FT                   /translation="MTHRFSWLRFAAAACVAGTAFAAVPAHAGIFDDDQARQAILDLRS
FT                   KTDSLSGQLSAAQRTILDQSNRLDQLNQQVATLRGQNEDLGNQLATLQKQQKDYYTDLD
FT                   TRLKKFEPQQQTVDGVQGEVQPGETESFNAASQQFRNGDFKNAAASFRTFISRFPNSPY
FT                   QPTAQYWLGNALYALRDYKGSTAIWQGVVKNYPQHPRAPEALLAIANNQLEQGQKAAAR
FT                   KTLEQIVAQYSGSDVAQSAQSKLSQIK"
     atgacgcatc gtttctcctg gctgcggttt gccgcagcgg cctgtgtcgc gggcacggcc        60
     ttcgcggccg tgcccgcgca tgcgggcatc ttcgacgacg atcaggcccg tcaggccatt       120
     ctcgatctgc gctcgaagac cgatagcctg tcgggtcagt tgtcggccgc gcaacgcacg       180
     atcctcgatc agtccaaccg tctcgaccag ttgaaccagc aggtcgctac gctgcgcgga       240
     cagaacgagg acctgggcaa ccagctcgcc acgctgcaaa agcagcagaa ggactactac       300
     accgatctgg atacgcgcct gaagaaattc gagccgcagc agcaaacggt ggacggcgtc       360
     cagggcgagg tgcagccggg tgagaccgag tcgttcaacg cggcttcgca gcaattccgc       420
     aatggcgact tcaagaatgc ggcggcgtcg ttccgcactt tcatctccag gttcccgaac       480
     agcccttacc agccgacagc gcagtactgg ctgggcaacg cgctgtatgc gctgcgcgac       540
     tacaagggct cgacggcgat ctggcaaggc gtggtgaaga actatccgca gcatccgcgt       600
     gcgccggaag cgctgcttgc gattgcgaac aatcagctcg agcagggtca gaaggctgcg       660
     gcccgcaaga cgctggagca gatcgtcgcg cagtacagcg gctcggacgt cgcgcaatcg       720
     gctcaaagca agctttcgca gatcaagtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page