(data stored in ACNUC7421 zone)

EMBL: CP000270.PE538

CP000270.PE538       Location/Qualifiers
FT   CDS_pept        complement(607616..608125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3921"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29076"
FT                   /db_xref="GOA:Q145B3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B3"
FT                   /protein_id="ABE29076.1"
FT                   /translation="MMSKLRFAFAVLMVGALAACHSGVKLDENANKGGSVSAQPNPNDV
FT                   ATVNVDPLNDPNSPLAKRSIYFDFDSYSVKDDYQSLLQQHAQYLKSHPQRHVLIQGNTD
FT                   ERGTSEYNLALGQKRAEAVRRSLSLMGVTDSQMEAVSLGKEKPQATGHDESSWAQNRRA
FT                   DLVYQQ"
     atgatgtcaa aacttcgctt tgcttttgct gtattgatgg tcggtgcgct ggccgcgtgc        60
     cactcgggcg tcaagctcga cgaaaacgct aacaagggtg gttcggtctc ggcacagccg       120
     aacccgaacg atgtcgcaac ggtcaacgtc gacccgctga acgatccgaa tagcccgctc       180
     gccaagcgca gcatctactt cgacttcgac agctactcgg tgaaagacga ctatcaatcg       240
     ctgctgcaac aacacgcgca atacctgaag agccatccgc aacgccacgt cctgatccag       300
     ggcaacaccg acgaacgcgg caccagcgag tacaacctgg cactcggcca gaagcgtgct       360
     gaggctgtgc gccgttcgct gtcgctgatg ggcgtgacgg actcgcaaat ggaagccgtg       420
     agcctcggca aggaaaagcc gcaagctacg ggtcatgacg aatcgtcgtg ggcacaaaac       480
     cgccgcgccg acctcgtgta ccaacagtaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page