(data stored in ACNUC7421 zone)

EMBL: CP000270.PE539

CP000270.PE539       Location/Qualifiers
FT   CDS_pept        complement(608158..609450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3920"
FT                   /product="Putative periplasmic TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29077"
FT                   /db_xref="GOA:Q145B2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145B2"
FT                   /protein_id="ABE29077.1"
FT                   /translation="MSLMTKLGLRTLVASCLIAVGGAANAQLNVLVTGVGSTQFPIATA
FT                   NFANEANSPQQVSTIVRQDLQRSGKFTNIDAGATPVSETDSVDLGSWKAKGANAFVSGS
FT                   VNRLPNGQYEVRFKLYDTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGGRGVFA
FT                   TRLSYVIKTGGRYQLQISDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIV
FT                   YIHDLPTGRRIVVSDQKGNNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQ
FT                   GSSIDTEPCFSPDGQSIYFTSDRGGQPQIYKMSAQGENAGAAQRVTFTGSYNTSPRVSP
FT                   DGKQLAYISRVGGGFKLYIQDLQGNTATGLTDTTHDESPSFAANGQYILYATQVNGRGV
FT                   LAAVSTDGRTRQVLSVQGGSVREPSWGPFMQ"
     atgagtttga tgaccaagct aggcctgcgg acacttgtag cgtcgtgcct gatcgccgtc        60
     ggcggtgccg ccaacgcaca actcaacgtc ctcgtgacgg gcgtcgggtc cacccagttt       120
     ccgatcgcaa cggcgaattt tgccaatgaa gcgaactcgc cgcagcaggt cagcacgatc       180
     gtgcgtcagg atctgcaacg cagcggcaaa ttcacgaaca tcgacgcggg cgccacgccg       240
     gtgtccgaaa cggattccgt cgacctcggc agctggaagg ccaagggcgc caacgcattc       300
     gtgtcgggca gcgtgaaccg cctgccgaac ggccagtatg aagtgcgctt caagctgtac       360
     gacaccgtca agggcgagag cctcggcggc ctcgtgctgg tgagcccgga aagcggcttg       420
     cgcatgagcg cgcacaaggt cgcggactat atctacgcga agctgatggg tggccgcggc       480
     gtgttcgcca cgcgcctgtc gtacgtcatc aagacgggcg gccgttatca gttgcagatc       540
     tccgattcgg acggccagga cgcgcacatc gcgctgtcga gccccgagcc gatcatctcg       600
     ccggcatggt cgcctgacgg caccaaggtc gcttacgttt cgttcgaaaa gaagaagccg       660
     atcgtttata tccacgatct gcccacgggg cgccgcatcg tggtgtcgga ccagaaaggc       720
     aacaacagcg cgccggcctg gtcgccggac ggacgcacgc tggcggtcgc actctcgcgc       780
     accggcaaca cacagatttt cgccgtcaat gcagacggca gcggcctgcg gcgtctcacg       840
     caaggcagct cgatcgacac cgaaccgtgt ttctcgcctg acggccagtc gatctatttc       900
     accagcgacc gtggcggcca gccgcaaatc tacaagatgt cggcccaggg cgaaaacgcc       960
     ggcgccgcac agcgcgtcac gttcacgggc agctacaaca ccagcccgcg cgtgagcccg      1020
     gacggcaagc agctcgctta tatctcgcgc gtcggcggcg ggttcaagct ttatatccag      1080
     gacctgcagg gtaacaccgc cacaggcctg acggacacga cacatgacga atcgccgagc      1140
     ttcgcggcga acggtcagta cattctttac gccacacagg tgaacggccg tggcgtgttg      1200
     gccgcagtat cgaccgacgg tcgcactcgg caggtcctgt ccgttcaggg tggcagcgta      1260
     cgcgagccgt cctggggccc gtttatgcaa taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page