(data stored in ACNUC7421 zone)

EMBL: CP000270.PE540

CP000270.PE540       Location/Qualifiers
FT   CDS_pept        complement(609589..610632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3919"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3919"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29078"
FT                   /db_xref="GOA:Q145B1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B1"
FT                   /protein_id="ABE29078.1"
FT                   /translation="MIRKNSEYPLQPPRERGTGRAFVFALVMHALLGFFLYHGIQWQNS
FT                   TPEGAEAELWTEVPDTSIPRPVPPPVPVPVAPAPPMRDEQADIALQEKKRQQQEAAREA
FT                   QLAEQQRQQKLQAQQEAEAKRQQQLAADQAAQKAAAARQKQLQLQQQQQQQQQQQEASK
FT                   LKQQQLAEQQKQQQLKEQQQEQQQKQAEAEAQKKADAQKAAKAKAQADAAAQAKKLDAE
FT                   RRARLAQMQGLAATGTGSTTSDGLGKSGTGSGSGGTATSPGYSDKVRRAVRPNITWGGE
FT                   TSGLETVVSVRCSPTGTLLGATISRSSGNPAWDDAALRAVQRTDPMPQDINGKTPTSFL
FT                   ITLRPAG"
     atgatccgca agaattccga atacccgctc cagccaccgc gtgaacgcgg caccgggcga        60
     gcctttgtgt tcgctctcgt gatgcacgcg ctgctcgggt tcttcctgta tcacggcatt       120
     cagtggcaaa acagtacgcc cgaaggcgcg gaagcggagc tgtggaccga agtgccggat       180
     acgtcgatcc cgcgcccggt tccgccgccg gtaccggtgc cggtggctcc tgctccgccg       240
     atgcgggacg aacaggccga catcgcgctg caggaaaaga agcgtcagca acaggaagcg       300
     gctcgcgagg ctcagttggc cgaacagcag cgtcagcaga aactgcaggc ccagcaggaa       360
     gccgaggcga agcgtcagca gcaactggcc gcggaccagg ccgcgcagaa ggccgcggcg       420
     gccagacaga aacagctaca gctacagcag cagcaacagc aacagcaaca gcagcaggag       480
     gccagcaagc tgaagcaaca gcaattggcc gagcagcaaa agcagcagca gttgaaagaa       540
     cagcagcagg aacagcaaca gaagcaggcc gaggctgagg cgcagaagaa ggccgacgcg       600
     cagaaagccg cgaaggccaa ggcgcaggcg gacgccgcgg cgcaagcgaa gaaactggat       660
     gcggagcgcc gcgcgcggct cgcgcagatg cagggtctcg ccgccaccgg caccggctcg       720
     accacgagcg atgggctcgg aaagagcggc acgggcagcg gctcgggtgg cacggcgacg       780
     tcgccgggtt actccgacaa ggtgcgtcgt gcggtgcgcc cgaatatcac ctggggcggt       840
     gaaacgagcg gcctggagac agtggtctcc gtgcgttgct cgccgaccgg caccttgctt       900
     ggcgcaacga tttcgcgcag cagcggcaac ccggcgtggg acgacgcggc gctgcgggcc       960
     gtccagcgta ccgatccgat gcctcaggac atcaatggca agaccccgac cagcttcctg      1020
     attacgttgc gcccggccgg ttga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page