(data stored in ACNUC7421 zone)

EMBL: CP000270.PE541

CP000270.PE541       Location/Qualifiers
FT   CDS_pept        complement(610629..611075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3918"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3918"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29079"
FT                   /db_xref="GOA:Q145B0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B0"
FT                   /protein_id="ABE29079.1"
FT                   /translation="MAGSRSSSMRGSRSRRAMADINVVPYIDVMLVLLVIFMVTAPLVA
FT                   PSIVNLPTVGGAAPQQQTPPVIVNIRADGNMSVKYKDDSGAQQQEDMTKADLNSFIAER
FT                   AQSHPDQPVVIAADKTVKYEVVMNVMSELKARGVKRVGLLVKSQ"
     atggcaggct ctcgttcctc cagcatgcgc ggcagccgct cgcgccgcgc gatggccgac        60
     atcaacgtcg tgccgtatat cgacgtgatg ctcgtgctgc tcgtgatctt catggtgacc       120
     gcgccgctcg ttgctccgtc gatcgtcaat ctgccgaccg tcggtggcgc agcgccgcag       180
     cagcaaacgc cgcccgtcat cgtgaacatt cgcgcggacg gcaacatgag cgtcaaatac       240
     aaggacgatt cgggtgcgca gcagcaggaa gacatgacca aggccgatct gaacagcttc       300
     atcgccgagc gcgcgcaatc gcatcctgat cagcccgtcg tgatcgccgc cgacaaaacg       360
     gtcaagtacg aagtcgtgat gaatgtgatg tccgaactga aagctcgcgg cgtcaagcgc       420
     gttggattgc tcgtcaaatc gcaatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page