(data stored in ACNUC7421 zone)

EMBL: CP000270.PE542

CP000270.PE542       Location/Qualifiers
FT   CDS_pept        complement(611086..611763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3917"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3917"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29080"
FT                   /db_xref="GOA:Q145A9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A9"
FT                   /protein_id="ABE29080.1"
FT                   /translation="MNTTQDLSIVSLVLNASLLAQAVMALLLLLSLLSWTFIFRKWFAI
FT                   RRARTQTERFERDFWSGGDLQALYQSAANNRHTIGALERIFESGMREFLKGKEKRLNDP
FT                   SAILDGARRAMRAAFQREMDVLEANLAFLASVGSVSPYIGLFGTVWGIMNAFRGLANVQ
FT                   QATLANVAPGIAEALTATAIGLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQR
FT                   QAQ"
     atgaacacta cacaagatct gtcgatcgtt tccctcgtac tcaatgcgag cctgctggcg        60
     caggccgtca tggctctgct gctgctgttg tcgctgttgt cgtggacttt catcttccgc       120
     aagtggtttg cgatccgccg ggcgcgcacg caaactgagc gtttcgaacg cgatttctgg       180
     tcgggcggcg acctgcaggc gctttatcag agcgccgcga acaatcgcca taccatcggc       240
     gcactggaac ggattttcga gtccggcatg cgcgaattcc tgaaaggcaa ggaaaagcgc       300
     ctgaacgatc cgagcgcgat tctcgacggc gcacggcgcg ccatgcgtgc cgcgttccag       360
     cgtgaaatgg acgtgctcga agccaatctc gcatttctcg cgtcggtcgg ctcggtcagc       420
     ccgtatatcg gtctgttcgg cacggtgtgg gggatcatga atgcgttccg cggcctcgcc       480
     aacgtgcagc aggccacgct ggcgaacgtc gcgccgggca tcgccgaagc actcaccgct       540
     accgcaattg gcctgttcgc tgcgattccg gccgtagttg cctacaatcg ctacgcgcac       600
     gacatcgacc gtctggcgat ccgcttcgag accttcatcg aagaattctc gaacatcctg       660
     cagcgccagg cacagtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page