(data stored in ACNUC7421 zone)

EMBL: CP000270.PE547

CP000270.PE547       Location/Qualifiers
FT   CDS_pept        615670..616230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3912"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3912"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29085"
FT                   /db_xref="GOA:Q145A4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A4"
FT                   /protein_id="ABE29085.1"
FT                   /translation="MKWNAVGWPRCRGFTLVETLAVVALLAVIAVMSTPSFVAWYVRDQ
FT                   VDARAKALVATLAYARSEALRQGARVTVCRTDGARHCLAAGQPCGNGIADWSCGWAVLA
FT                   ERGGALSLLRAQPLLAAVSIAGTQTNLTFTPPAGQLIGTFRSFDIAPRAPSRATQGARW
FT                   RRCIRIAAGGRARITEGACGAAS"
     atgaaatgga atgcagtcgg ttggccgcgg tgccgcggct tcacgcttgt cgaaacgctg        60
     gccgtcgtcg cgctgctggc ggtgatcgcc gtgatgagca cgccgtcgtt cgtagcgtgg       120
     tacgtgcgcg atcaggtcga cgcccgtgcg aaggcgcttg tcgcgacgct cgcttatgcg       180
     cgcagtgaag cgctacggca gggcgcgcgc gtcactgtgt gccggaccga cggggcgcgg       240
     cattgtctcg cggcgggaca gccgtgcggc aatggtatcg ctgactggtc ctgtggctgg       300
     gcggttctgg ccgaacgagg cggcgcgtta tcgctattgc gtgcgcagcc gctgcttgct       360
     gccgtgagca ttgccggcac gcagaccaac ctcacgttca cgccgccggc gggacaattg       420
     atcggcacct tccgcagttt cgatattgcg ccgcgcgcgc catcgagagc tacgcaagga       480
     gccaggtggc gtcgctgcat tcgtatcgca gcgggcggtc gcgcgcggat caccgagggc       540
     gcatgcggag cggcatcatg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page