(data stored in ACNUC7421 zone)

EMBL: CP000270.PE549

CP000270.PE549       Location/Qualifiers
FT   CDS_pept        617644..618090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3910"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3910"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29087"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A2"
FT                   /protein_id="ABE29087.1"
FT                   /translation="MMLATSAAWFETSLAAARGAINVREYLQAFHAADSALTLCVRNAI
FT                   AAAAVQTSAPPPIASGEPTQWKLEAAFEAGAILPVAQWPGSLRPPQCLIEAWRLASRAD
FT                   ARAYLLTSRGFGRTRESQVWLQIELVIDGDKIERHWRHVASRPF"
     atgatgctgg ccacttccgc tgcctggttc gagacctcgc tggcggccgc gcgtggcgct        60
     atcaacgttc gcgagtacct gcaggctttt catgccgcgg attcggcgct gactttgtgc       120
     gtccgcaatg ctatcgcggc ggcagccgtc cagacctcgg cgccgccgcc gatcgcatcc       180
     ggcgagccga cccaatggaa actcgaagcc gcgttcgaag ctggcgccat cttgcccgtg       240
     gcgcaatggc ccggatcgct gcggccgcct cagtgcctga ttgaggcctg gcgtcttgcc       300
     agtcgcgccg atgctcgagc gtacttattg acgtcgcgcg gcttcggccg aacgagggag       360
     tctcaggtgt ggttgcagat cgagttggtg atagacggag acaaaattga acgtcattgg       420
     cgccacgttg ccagcaggcc tttttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page