(data stored in ACNUC7421 zone)

EMBL: CP000270.PE552

CP000270.PE552       Location/Qualifiers
FT   CDS_pept        complement(619248..619634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3907"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3907"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29090"
FT                   /db_xref="GOA:Q144Z9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z9"
FT                   /protein_id="ABE29090.1"
FT                   /translation="MTIDTQSQRGEHSPLRRIIGSVFAILQTRLELVGIELAEEKDRLL
FT                   GVLFLGLAAMMLATMALIALTALIAIAFWDTYRWQALAGITAVYAIAGLACALKARSGL
FT                   RNAPMVFEATIAEFEKDRDVFRKP"
     atgacgatcg acacacaatc gcagcgcgga gaacatagtc ccttgcgccg cataatcggt        60
     tccgtgtttg ccattctgca gacgcggctg gaactggtcg gcattgaact cgccgaagaa       120
     aaagaccgtc tgctcggcgt gctgttcctt ggcctcgcgg ccatgatgct cgccacgatg       180
     gccttgatcg cgctgacagc actgatcgcc attgcattct gggacaccta ccgctggcaa       240
     gcgctcgccg gcatcaccgc ggtctatgcg atcgcgggat tagcctgtgc gctgaaagcg       300
     cgcagcggct tgcgcaacgc gccaatggtg ttcgaagcga ccattgccga gttcgaaaaa       360
     gaccgcgacg tgttccgcaa accgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page