(data stored in ACNUC7421 zone)

EMBL: CP000270.PE571

CP000270.PE571       Location/Qualifiers
FT   CDS_pept        641497..641754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3888"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3888"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29109"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y0"
FT                   /protein_id="ABE29109.1"
FT                   /translation="MLELLIDTGEDYQREAEIDSELYQVIALDAKEVPQSRIKARHAAN
FT                   LLAKALRKPSDNRERIGATRVVPSRAIRFKTMARRIATAH"
     ttgctggagc tgctgatcga cacgggcgag gattaccaga gggaggccga gatcgacagt        60
     gagttgtatc aggtcattgc actggacgcg aaagaagtac ctcaaagccg gatcaaggcg       120
     cgtcacgcgg cgaaccttct ggccaaggcg cttcggaagc catcagacaa tcgcgaacga       180
     atcggcgcaa ccagggtagt gccgagcagg gcgattcgct tcaaaacgat ggcgcgacgt       240
     atagcaacgg cgcactga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page