(data stored in ACNUC7421 zone)

EMBL: CP000270.PE579

CP000270.PE579       Location/Qualifiers
FT   CDS_pept        complement(650599..652083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3881"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3881"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29117"
FT                   /db_xref="GOA:Q144X2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X2"
FT                   /protein_id="ABE29117.1"
FT                   /translation="MKPATGRRSPPRLVARFVAISWRDLAVSFGPILLIAAVAIWVAVR
FT                   LIQPAPPNTLTISAGPEGSTFWNAAQKYKEILARNRITLNVLSSEGSLQNLKRLSDPKS
FT                   NVDVGFVQDGVAPGPAARGLMSLGSVAYVPLAIFYHGPTVTRLSEFKGERLAVGAEGSG
FT                   TRELALALLKANGIVPGGATRLLPLSGDDAASALVSGKVDAAFLAGDSAQPAVMGKLYR
FT                   TPNVQFYDFSQADAYTRRFPYLTQLTMPMGAFDLGKNLPAAPIHMVAPTAELVARDSLH
FT                   PALSDLLIEAAREVHGKANILQRAGEFPAPLAHDFPISDDAARYYKSGKSFLYRILPFW
FT                   LASLADRLLVVVVPLIVLLVPALRLVPSLYAWRVKSRIYRWYGALIAIERSALSDHSPT
FT                   ERASLLERLDAIEESVNGLKMPLAYADQFYVLREHIGFVRQRLTQPRETQRDGAGNETQ
FT                   GTGNGPGEAGAPPAPSAANEAAEIGETPNGGAAKPY"
     atgaagcctg ccaccggccg cagaagccct ccccgtctcg tcgcccgttt cgtcgcgatc        60
     tcctggcgcg atctcgccgt ctcgttcggg ccgatcctgc tgatcgccgc cgttgcgatc       120
     tgggtcgccg tgcgtctgat ccagccggca ccgcccaaca cgctgacaat cagcgccggc       180
     ccggaaggca gcaccttctg gaacgcggcg cagaagtaca aggagattct ggcgcgcaac       240
     cgcatcacgc tgaatgtgct gtcctcggaa ggctcgctgc agaatctcaa gcgcctgtcc       300
     gatccgaagt cgaacgtgga tgtcggcttc gtgcaggacg gcgtcgcgcc cggcccggca       360
     gcccgaggtc tcatgtcgct cggcagcgtg gcctatgtgc cgctcgcgat cttctatcac       420
     ggcccgaccg tcacgcggct ctccgaattc aagggcgagc ggctcgcggt cggcgccgaa       480
     ggcagtggca cgcgcgagct ggcgctcgcg ctcctcaagg ccaacggcat cgtgccgggc       540
     ggcgcgaccc ggctgctgcc gctctcgggc gacgacgccg ccagcgcact cgtctccggc       600
     aaggtcgacg cggcgttcct cgccggcgat tcggcgcaac cggctgtgat gggcaagctc       660
     taccgcacgc cgaacgtgca gttctacgat ttctcgcagg ccgacgccta cacgcgccgc       720
     tttccctatc tgacccagct cacgatgccc atgggcgcgt tcgacctcgg caagaatctg       780
     ccggccgcgc cgattcatat ggtggcgccg accgccgagc tggtggcgcg cgactcgctg       840
     catcccgcgc tgtccgatct gttgatcgag gccgcgcgcg aggtgcacgg caaggcgaac       900
     atcctgcagc gcgccggcga attccccgcg ccgctcgcgc acgatttccc gatcagcgac       960
     gacgccgcgc gctactacaa gtcgggcaag agcttcctct accggatcct gccgttctgg      1020
     ctcgcgagtc tcgccgaccg gctgctggtg gtcgtggtgc cgctgatcgt gctgctggtg      1080
     ccggccttgc gtctcgtgcc gtcgctgtat gcatggcggg tgaaatcgcg catctatcgc      1140
     tggtacggcg cgctgatcgc gatcgaacgc agcgcgctca gcgaccattc gcccaccgaa      1200
     cgcgcgtcgc tgctcgaacg gctcgacgct atcgaggaat ccgtcaacgg tctgaagatg      1260
     ccgctcgcct acgccgatca gttttacgtg ctgcgcgagc acatcggctt cgtgcgccag      1320
     cgtctcacgc agccgcgcga gacgcagcgc gacggcgccg ggaatgaaac gcaaggcacg      1380
     ggcaacgggc ccggcgaagc cggcgctccg cccgcgccgt ccgccgcgaa cgaagcggct      1440
     gaaatcggcg aaacgcccaa cggcggcgcc gcgaaaccat attga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page