(data stored in ACNUC7421 zone)

EMBL: CP000270.PE582

CP000270.PE582       Location/Qualifiers
FT   CDS_pept        complement(653545..654333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3878"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29120"
FT                   /db_xref="GOA:Q144W9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W9"
FT                   /protein_id="ABE29120.1"
FT                   /translation="MALPHIDLLYSVSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPA
FT                   TAVGTDLLYAAATKATGTLVHGLKGSVDWQITLRLAAGSVPAATLTLILLHRYGMDTPG
FT                   AGRLIQIVLGAALLITAVALVFRPQLAALGARKQRTPRQGRTLALTMLTGAVLGVLVSL
FT                   TSVGAGAIGVTVLLLLYPLLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSIDWSMLLSLL
FT                   VGSLPGIAIGSYLSSRAPDALLRNLLAATLTLVGVRLVLA"
     atggctcttc cccacatcga tctgctgtac tccgtctccg gcctgttcgt cggctttctg        60
     gtgggactga cgggcgtcgg cggcggctcg ctgatgacgc cgatcctggt tctgctattc       120
     aacgtgcatc cggccaccgc cgtcggcacc gacctgctgt acgcggcggc caccaaggca       180
     accggcacgc tcgtgcacgg cctgaaaggc tccgtcgact ggcagatcac cctgcgcctc       240
     gccgccggca gcgtgccggc cgccaccctc acgctgattc tgctgcatcg ttacggcatg       300
     gacacgccgg gcgccggccg cctgatccag atcgtgctcg gtgcggcgtt gttgatcacg       360
     gcggtggcgc tggtgtttcg cccgcagctc gcggcgctcg gcgcccgcaa gcaacgcacg       420
     ccgcgccagg gccgcacgct cgcgctgacc atgctgaccg gcgcggtgct cggcgtgctg       480
     gtgtcgctga cgtcggtcgg tgcgggcgcc atcggcgtga cggtgttgct gttgctctat       540
     ccgcttctgc cgaccacgcg catcgtgggt tccgacatcg cgcacgcagt gccgctcacg       600
     ctgctggcgg gcgccggtca ttggctgctg ggctcgatcg actggtcgat gctgttgtcg       660
     ctgctggtgg ggtcgctgcc gggcatcgcg atcggcagct atctgtcctc acgcgcgccg       720
     gatgcgctgc tgcgcaacct gctcgccgcc acgctcacgc tggtcggcgt gcgcctcgtg       780
     ctggcctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page