(data stored in ACNUC7421 zone)

EMBL: CP000270.PE583

CP000270.PE583       Location/Qualifiers
FT   CDS_pept        complement(654539..655204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3877"
FT                   /product="Putative amino acid exporter, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3877"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29121"
FT                   /db_xref="GOA:Q144W8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W8"
FT                   /protein_id="ABE29121.1"
FT                   /translation="MSTTSLFFTAAGVGLAIAAPVGPMGMLCIRRTLTGGPRAGLAIGF
FT                   GIATGDAAYGLIAALGLVGISQFMLAYDRPLHLLAGLFLLYLGVRTLLQKAPAEAANGP
FT                   SPTGDTTNGNGKLAQVGRAGALRAYVSSLLLTLTNPQTVIMFAALFTTLAPRGAFSSSI
FT                   ALTTVGGVFCGSIAWWCFLVTVVSLARHAIGSRLRVAIDRIVGFTLAAFGVVEIRRAL"
     atgtccacca ccagtctctt cttcaccgct gcgggcgtcg ggctcgccat tgccgcgccg        60
     gtcggtccga tgggcatgct gtgcatccgc cgcacgctga ccggcggtcc gcgcgccgga       120
     ctcgcgatcg gcttcggcat tgcgaccggc gacgcggctt atggtctgat cgcggcgctc       180
     ggcctcgtcg gcatctcgca gttcatgctc gcgtatgacc ggccgttgca tctgctcgcc       240
     gggttgttcc tgttgtatct gggcgtgcgc acgctgcttc agaaagcgcc cgccgaggcg       300
     gcaaatggcc cgagcccgac aggcgacaca acgaacggca acggcaagct cgcgcaggtg       360
     ggccgcgccg gcgcgctgcg cgcctatgtg agttctttgc tgctcacgct gaccaatccg       420
     caaacggtca tcatgttcgc cgcgctgttc acgacgctcg ccccgcgcgg cgcgttttca       480
     tcgagcattg cgctgaccac ggtaggcggc gtattttgcg gctcgatcgc gtggtggtgc       540
     ttcctcgtca ccgtggtctc gctcgcgcgc catgcgatcg gcagcagact gcgcgtcgcc       600
     atcgaccgga tcgtgggctt cacgctggcg gcattcggcg tcgtggaaat tcgccgggcg       660
     ctgtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page