(data stored in ACNUC7421 zone)

EMBL: CP000270.PE591

CP000270.PE591       Location/Qualifiers
FT   CDS_pept        665860..666162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3869"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3869"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29129"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W0"
FT                   /protein_id="ABE29129.1"
FT                   /translation="MFVLLIATPQIYRQKKCRLALARSRCRYSEGGCAHSDVAAGKSHF
FT                   KSVWRRMVRIVTRPFSSSRCVCGGVRNASFICINIRRMPIHSYVESAINPLKRQR"
     atgttcgttt tacttattgc cactccgcag atttatcgtc agaagaaatg caggctggcg        60
     ttagcgcgga gcagatgccg gtatagcgaa ggtggctgcg ctcattctga cgttgcggcg       120
     ggaaaaagtc acttcaaatc cgtttggcgg cggatggttc gaattgtaac tcggccgttt       180
     tcgagtagtc gctgtgtgtg cggtggcgta cgaaatgcca gttttatttg cattaacatt       240
     cgcagaatgc caattcattc atatgtggaa tcggcaatta atccgttgaa aagacagcgg       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page