(data stored in ACNUC7421 zone)

EMBL: CP000270.PE601

CP000270.PE601       Location/Qualifiers
FT   CDS_pept        complement(678773..679267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3859"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29139"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V0"
FT                   /protein_id="ABE29139.1"
FT                   /translation="MTTSLRHTASWMFFAIASCALPAFAQNAAPNPAAAAPAATAANDY
FT                   GVNAQLPANRRTAHRNSEQALLGAPNPYGTDNAQDNTDDAQRTALLDTQRMTVLGGGQG
FT                   AQPALGKGQRKAPAAANGQVRVAGQPGRPNPANALTPEAAATTTYADPYASKRGVYRSP
FT                   W"
     atgaccacct cgcttcgaca caccgctagc tggatgtttt tcgcgatcgc atcgtgcgcg        60
     ttgccggcgt tcgcgcaaaa cgccgcgccc aatcccgcgg cggccgcacc cgccgcgacg       120
     gccgccaacg actatggcgt caatgcccag cttcccgcca accggcgcac cgcgcatcgc       180
     aacagcgagc aggcgctgct cggcgctccc aacccatacg gcacggacaa cgcgcaggac       240
     aataccgacg acgcccagcg caccgcgctg ctcgatacgc aacgcatgac ggtgctgggc       300
     ggcggccagg gcgcacaacc cgcgctcggc aaaggccagc gcaaagcgcc ggccgcggcc       360
     aacggccagg tgcgcgtggc cggccagcca ggccgtccga accccgctaa cgcgctgacg       420
     cccgaagccg cggcgaccac cacgtacgcc gatccctatg cgagcaagcg cggcgtctat       480
     cgctctccgt ggtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page