(data stored in ACNUC7421 zone)

EMBL: CP000270.PE605

CP000270.PE605       Location/Qualifiers
FT   CDS_pept        complement(683386..684879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3855"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29143"
FT                   /db_xref="GOA:Q144U6"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U6"
FT                   /protein_id="ABE29143.1"
FT                   /translation="MRHQYATPWIWIFLIPLAFDYKATDANTGHFAQFIFVLPAIAAGI
FT                   ALLLIAPRFHERSRLRSAVTWSMMLCVFGSIVAQLVQDNDSGNYLRVLLPFILFMLGYL
FT                   VACRPWSEFRIAQFEKALFIANVISLVFTMVYGLATGGDLEDVRFRILSVTLLGLQGVL
FT                   LHEFVVAKRFSFFTVGVFALSILIELLSVTRSVLVGTVLLFLIAVALSAPSIQHIWRAM
FT                   SRSIIIGAVLAGIAGVAALSFPTVAEHWTQRIFASEETRSGKDPTTITRLAEMRDQYDQ
FT                   VTADPAALWFGEGYGHYYRYSPVYLPDLAGQISEKDFYAINEWAAGHNFWVYQFFAGGL
FT                   LFGLAMPLVTLAALAICFFSYRYWRSVVPDAPMLPVLGRAIMLFAALPATSIGGNPLGP
FT                   RFSGLIFGVALGLMIATHARLQRALPARARRLRRPPYVRPDAMPELPGRVQPGMGRADL
FT                   PSTLGMSRTAHTARDSGQFGALVPHTPPRHRSNRPDIVR"
     atgcgtcatc agtatgcaac gccctggata tggattttcc tgataccgct tgcgttcgac        60
     tataaggcga ccgacgcgaa tacaggtcac ttcgcgcagt tcatcttcgt ccttccggcg       120
     atcgccgcgg ggattgccct gcttctcatc gcaccgcgtt ttcacgagcg ttcgcggcta       180
     cgctcggccg tcacgtggag catgatgctg tgcgtgttcg gcagcatcgt cgcgcaactg       240
     gttcaggaca acgattccgg caactatctg cgggtgctgc tgccgttcat cctcttcatg       300
     ctcggctatc tcgtggcgtg ccgcccgtgg agcgagtttc gcatcgccca gttcgaaaaa       360
     gccctgttca ttgccaacgt catcagcctc gtgttcacga tggtctacgg cctcgcgacc       420
     ggcggcgatc tcgaggacgt gcgtttccgc atcctctccg tgacgctgct gggtttgcaa       480
     ggcgtgttgc tgcatgaatt cgtcgtggcg aagcgttttt ccttttttac cgtgggcgtg       540
     ttcgcgctca gtatcctgat cgaattgctg agcgtcaccc gcagcgtgct ggtcggcacc       600
     gtgctgctgt tcctgatcgc cgtggcgctc agcgcgccgt cgatccagca tatctggcgc       660
     gccatgagcc gcagcatcat catcggtgcc gtgctcgccg gcatcgcggg cgtcgccgcc       720
     ttgagttttc cgaccgtcgc cgagcactgg acgcagcgca ttttcgcttc cgaggaaacg       780
     cgctccggca aggatccgac caccatcacg cgtctcgcgg aaatgcgcga ccagtacgat       840
     caggtgacgg cggacccggc ggcgttatgg ttcggcgaag gctacggcca ttactatcgc       900
     tactcgccgg tctatctgcc ggatctcgcc ggccagatca gcgagaaaga cttctatgcg       960
     atcaatgaat gggccgcggg acacaacttc tgggtctatc agttcttcgc gggcggcctg      1020
     ctgttcggcc tcgccatgcc gctggtcacg ctcgcggcgc tggcgatctg cttcttctcg      1080
     tatcgatact ggcgctcggt cgtgccggac gcgccgatgc tgccggtgct ggggcgcgcc      1140
     atcatgctgt ttgccgcttt accggccacc tcgatcggcg gcaatccgct cgggccgcgt      1200
     ttttccggcc tgatattcgg cgtcgcgctc ggcttgatga tcgccacgca cgcgcgtttg      1260
     cagcgcgcac tgccggcgcg cgcgagacgc ttgcgccgcc cgccatacgt gcgcccggac      1320
     gcgatgcccg aattgccggg cagggtccag ccgggcatgg gccgcgccga cctgccgtcc      1380
     acgctcggca tgtcgcgcac ggcgcacacc gcgcgcgact ccggccagtt cggcgccctc      1440
     gttccgcaca cgccgcccag gcaccgctcc aaccgacccg atatcgtccg atga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page