(data stored in ACNUC7421 zone)

EMBL: CP000270.PE608

CP000270.PE608       Location/Qualifiers
FT   CDS_pept        688497..688874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29146"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U3"
FT                   /protein_id="ABE29146.1"
FT                   /translation="MRCLPLSVGRGHLNEACLAGLASSVRLSTYVRSRCWGALRNPHGF
FT                   ARFPTTRRDCAAAYGQRITRLKKIQLFSGEAVVASIRSVGMIFHRVRPVVVALRVGILI
FT                   LADYQIIIHTNKNALTIRMNK"
     atgcgatgcc tgccgctcag cgtcggacgc ggacacctca atgaagcgtg ccttgctggt        60
     ctcgcgtctt cggtacgttt gagtacatat gtccgttctc ggtgctgggg cgcacttcga       120
     aatccgcacg ggttcgcgcg gtttcctacg accagaagag attgcgcggc ggcttatggg       180
     cagcgaatta cgcggctgaa gaaaatccaa ttgttttcag gtgaagccgt agtcgcgtcg       240
     attagatcag tcggaatgat ttttcataga gtaaggccgg tagttgtcgc tttaagggtc       300
     ggaattctta tattggcgga ttaccaaatc attattcata cgaataaaaa cgcgctgact       360
     attcgtatga ataaatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page