(data stored in ACNUC7421 zone)

EMBL: CP000270.PE609

CP000270.PE609       Location/Qualifiers
FT   CDS_pept        689201..690652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3851"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3851"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29147"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U2"
FT                   /protein_id="ABE29147.1"
FT                   /translation="MTFANRPKKQQVLPHSLYSSDPAASVPRRKFLAGLVAGAGTIALS
FT                   ACGGGGGDSPAAVANDATVANKAGSSGFTVTAPAANATVSGTITVSGTAGSNWRNVAVY
FT                   DHATVAKIGADTTPSGGKFAIQLDTTKLAAGSRQIDVVAFSVPAGQAGGTKTTQTITVN
FT                   VTRAASGSTSGALFYGMNGHLAWPDGIYHTMSAAAQLALLKDLGVTNYRVDVADAGMAQ
FT                   TVANALTGAFAGSGVAIMPCINAWSTSYNQYGSESAAYTLGYNLGASIAKPLKGLVKYI
FT                   ECGNELDSDGLITNGDGSNTNNYSPAIWPAFRGVIRGMIDGVKAIDPTIQCGVNVGVPL
FT                   AYRALQMLWSGITPDGSVNGVSGAAPIRWDYTTFHWYQSSGDIICGWRNNACVNVLQIL
FT                   KDSFNVPIWLTEWGWQGSQVTPAQQASYVTTALTEYRSLKDQYNIQSVQMYCLIDPDFG
FT                   LLQADGVTKNPSYSAFKKFVAANPV"
     atgaccttcg ctaaccgacc aaaaaaacag caagttcttc cgcattccct ctactcgtca        60
     gaccctgccg catctgtccc tcgaaggaaa ttcctcgccg gtctcgtcgc gggcgccgga       120
     acgatcgcac tttccgcatg cggcggtgga ggcggcgact ccccggcggc cgtggccaat       180
     gatgctactg tggccaataa ggccgggtcg agcggattca ccgtaacggc ccccgcggcc       240
     aatgcgactg tatccgggac catcacagtg agcggcaccg ccggcagcaa ctggcgcaat       300
     gtggccgtct acgaccacgc aaccgttgcc aagattggcg ccgacacgac gccgagcggc       360
     ggcaaatttg caatccagct tgatacgact aaattggctg cgggctcgcg ccagatcgat       420
     gtcgtcgcat tttcagttcc ggcgggacaa gccggcggca ccaagaccac gcagaccatc       480
     acggtcaacg tcacccgggc ggcttccggg tcgacttcgg gcgcactgtt ctacggtatg       540
     aatgggcacc ttgcatggcc cgacggcatt tatcacacca tgtcggcggc tgcccaactg       600
     gcgttgctca aggatctcgg tgtcacgaac tatcgtgtcg acgtggcaga tgcaggcatg       660
     gctcagaccg tcgctaacgc gttgaccggg gcgttcgccg gcagcggcgt ggccatcatg       720
     ccgtgtatca acgcctggtc gaccagctat aaccagtatg gttcggaatc ggccgcatac       780
     acgttgggct acaacctggg ggcctcgatc gccaagccgc tgaagggcct cgtcaagtac       840
     atcgagtgcg gtaacgaact cgactcggat ggcctgatta cgaacggcga cggcagcaac       900
     acgaacaact acagccccgc gatctggccg gcattccgcg gagtcattcg gggcatgatc       960
     gacggcgtga aggccatcga cccgactatc cagtgcggcg tcaacgttgg tgtcccgctc      1020
     gcctatcgcg ccttgcagat gctatggagc ggcatcacgc ccgatggctc ggtcaacggt      1080
     gtctccggtg cagcgccgat ccgctgggat tacacgactt tccactggta ccagagctcg      1140
     ggcgatatca tttgcggatg gcgaaacaac gcctgtgtga atgtgctgca aattctgaag      1200
     gactccttta acgtaccgat ctggttgact gagtggggct ggcaaggcag ccaggttacg      1260
     ccggcgcaac aggcgagcta cgtaaccact gcattgacgg agtatcgatc cctaaaggat      1320
     caatacaaca ttcagtctgt tcagatgtac tgtctgatcg atccggactt cggtctcctg      1380
     caggcagacg gcgtcacgaa aaatccgtcc tattccgcct tcaagaaatt cgtggccgcc      1440
     aatcccgtct aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page