(data stored in ACNUC7421 zone)

EMBL: CP000270.PE610

CP000270.PE610       Location/Qualifiers
FT   CDS_pept        690982..693336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3850"
FT                   /product="Protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3850"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29148"
FT                   /db_xref="GOA:Q144U1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U1"
FT                   /protein_id="ABE29148.1"
FT                   /translation="MNSSVSRTPPVMLRNNVDAFSIGELARHVVDNVWLVIGIVAVVTG
FT                   AAALYAFVATPIYSADALVKVDFPQPNALGEASKAQEQVVPPTLPTEAEIQIIQSRSVI
FT                   APVISKFRQDISITPNRIPVIGALISQFAAPGTPMAAPFGLGSFAWGGEEASVGSLTVP
FT                   AWLEDESLTLTVLPGGHYRLTDPKGRTLLTGAPGVPTQANGVALTMDRLIARPGTEFTL
FT                   VRFSDVKAIERFQHQLKVSESGKDTGVVQIIYENPDPELARAIANGIAQGYIASHIAQH
FT                   RAEALTTREFIVGELPQLHANLTQAEAELSQFRTASSSMQASTEAASYLQGSIEFDRQI
FT                   AMLKVQKAGLESHFAANSRDVQAIDNQLQLLENAKSAFEARFDQLPASERRSADLTRNV
FT                   KVAEDIYVAMVNKSNELAVTQAGTLGNVHIIDTALLPVDPVKPKRPLVIAVGAAGGLIL
FT                   AILYVFIRRLSSSALGNSIVAERHLNLPVFGHVLFSDEQARLDRVQNSNSQLAKKGLSG
FT                   KVQQTVAASATGSALRLTYSGVTPQDSMLAGGRFLLATDGYDDIPLEALRGIRATLQRQ
FT                   IQDAANNVLVVTGATPGTGKSFISSNLAVLSAEAGKRVLLIDGDMRRGQLAAIMKQTGA
FT                   GGLSEVLTGRIDVDHVIRNTDVHGLSFIAAGRYPSNPSQLLSTSRMQQLLERLGELYDV
FT                   VIVDTPPVLAVSDANLIASLAGSTVLVVRPDAQSDRELEEAAQRLDRAGARLVGMIFNA
FT                   MPRRRSEKRSYGYAAAYSAASVPPQQQHGAS"
     atgaattcga gtgtttcccg tactccgccg gttatgctac ggaacaacgt agatgcgttt        60
     tccatcggcg aactggcgcg gcatgttgtg gacaatgtat ggctggtgat tggcattgtc       120
     gccgtggtaa caggagcggc cgcgctgtac gcattcgtgg ccactcccat ttattccgcg       180
     gatgcgttgg tgaaagttga ttttcctcag cctaatgcgc ttggtgaagc gtcgaaggcg       240
     caggagcagg tcgtgccgcc cacgctgccc accgaagcgg agattcagat cattcagagc       300
     cggagcgtga ttgcgccggt gatcagtaaa ttcaggcagg acatctcgat tacgccgaat       360
     cgcatcccgg ttatcggcgc gctcatcagc caattcgccg cgccgggaac gccgatggcg       420
     gcacccttcg gtctgggctc tttcgcttgg ggcggagagg aagcgtccgt cggttcattg       480
     accgtgccgg cctggctcga agacgaatca ctcacgttga ccgttctgcc cggcggacac       540
     tacaggctca ccgatccaaa agggcgaacc ctgctaacgg gcgcacctgg cgtaccgacc       600
     caggccaacg gcgtggcgct cacgatggat cgcctcatcg cgcgccccgg aacggaattc       660
     acgctcgtgc gctttagcga tgtcaaggca atcgagcgtt ttcagcatca gttgaaagtc       720
     agcgagtcgg gtaaggacac cggggtcgtg caaatcatct acgagaatcc cgatccggaa       780
     ctggctcgcg caatcgccaa cggcattgcc caaggctata tcgcttctca tatcgcgcag       840
     catcgcgccg aagcgctgac cactcgcgaa tttatcgtgg gcgagttgcc gcagcttcac       900
     gctaacctga cgcaggcaga agccgaactg agtcagttca gaactgcatc gagctcgatg       960
     caggcgagta ccgaagccgc gtcctatctc cagggcagca ttgagtttga ccgtcagatc      1020
     gcaatgctca aggtgcagaa agccggtttg gaaagtcact ttgcagcgaa ctcgcgcgac      1080
     gtgcaggcca tcgataacca gctccagctc cttgaaaatg ccaagagcgc tttcgaggcg      1140
     cgctttgatc aattacccgc gtccgagcga cggtcggctg acctcacgcg caacgtcaag      1200
     gtcgccgagg atatctatgt agcgatggtc aacaaatcca acgaactggc ggtgacgcag      1260
     gccggaacgc tggggaacgt acatatcatc gacaccgccc tgttgcccgt agaccctgtg      1320
     aagccgaagc gaccgctggt gatagccgtg ggcgccgctg gcggtctgat cctggcgatc      1380
     ctgtacgtct ttatccggcg cctgtcgtcg tccgcgcttg ggaactcgat cgtggccgag      1440
     cgccatctga acctgcccgt ctttggtcac gtattgttca gtgacgagca ggcgcgcctt      1500
     gaccgcgtgc agaattcgaa ctcgcagctg gcgaaaaaag ggctttccgg taaggtgcag      1560
     cagacagtgg ccgcaagcgc aacaggatcg gcgctcagat tgacctatag cggcgttact      1620
     cctcaagaca gtatgttggc cggcggccgc ttcctgctcg ccactgacgg gtacgacgac      1680
     ataccgcttg aggctttgcg cggtatacgc gcgaccttgc aacggcagat tcaggacgcg      1740
     gccaataacg tgctcgtggt aacgggcgcg acgcccggca cgggaaagag ctttatctcg      1800
     tcgaatctgg ccgtgctcag cgccgaggcc ggcaaacggg tgttgctgat cgacggcgat      1860
     atgcgccggg gccaactggc cgcgataatg aagcagaccg gtgcgggcgg tctctccgaa      1920
     gttctgactg gccggatcga tgtcgaccac gtcattcgaa acacagatgt tcatggactt      1980
     tcgttcatcg ctgctgggcg ctatccgtcc aatccgtcgc agctgctctc gacatcgcgc      2040
     atgcaacagc tactcgagcg acttggcgaa ttgtatgacg tggtcattgt cgacactccg      2100
     cccgtgctgg cggtgagtga tgcaaacctg atcgcctctc ttgcaggatc gactgtgctc      2160
     gtggtgcgtc cggatgccca gagcgaccgg gagctggagg aggccgcgca acgtctcgat      2220
     cgcgccggcg cccgtctggt cggcatgata ttcaacgcga tgccgcgacg gcgcagcgag      2280
     aagcgcagct acggctatgc ggctgcctat tccgcagcga gcgtcccacc ccagcaacag      2340
     catggcgcct cgtaa                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page