(data stored in ACNUC7421 zone)

EMBL: CP000270.PE620

CP000270.PE620       Location/Qualifiers
FT   CDS_pept        704094..705482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3840"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3840"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29158"
FT                   /db_xref="GOA:Q144T1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T1"
FT                   /protein_id="ABE29158.1"
FT                   /translation="MEIFDAFHLARLQFAFTVSFHIIFPAISIGMASFLAVLEWRWLLT
FT                   GDVAYKDMFLFWSKIFAVGFGMGVVSGVVMAYEFGTNWSGFSSVAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWERVTPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGFAIEG
FT                   GRIVPVDWMKVIFNPSFPYRLAHMTIAAFIVAGFIVAACGAWHLLQGRRDKPVTRSFSM
FT                   ALWILLFLTPIQIFVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLVGLPDMDAEV
FT                   TRYTLQVPHLGSLILTHSWDGEIRGLKEFPPQDRPYSPIVFWTFRIMAGLGMLMLLTTL
FT                   LGLVLRVRGRLYETRWFQRFVLCMGPSGIVALLAGWITTEVGRQPWTVYGVLRTADSVS
FT                   PIGSQQAGVSLLIFVMVYFLVFGMGFYYMMKMMKRGPEEHVERRDSRRHPVLRNRPLDA
FT                   LEGE"
     atggaaatct tcgatgcatt ccaccttgcc aggttgcagt ttgcattcac ggtttcgttt        60
     catattattt tccccgccat cagcatcggc atggccagct tcctcgccgt gctggaatgg       120
     cgctggctgc tgaccggcga cgtcgcctac aaggacatgt tcctgttctg gtcgaagatc       180
     tttgcggtcg gcttcggcat gggggtggtc tcgggcgtgg tgatggccta cgagttcggc       240
     actaactgga gcggtttttc cagtgtggcc ggcaatatca cgggaccgct cctgacctat       300
     gaagtgctga cggcgttctt tctcgaagcc ggctttctcg gcgtcatgct gttcggctgg       360
     gaacgggtca cgccgcgcgc gcatttcttc gccacgctca tggtcgcggt gggcacgctg       420
     atttccactt tctggattct cgcgtcgaac agcttcatgc agacgccgca aggattcgct       480
     atcgagggtg gccgtatcgt gccggttgac tggatgaagg tgattttcaa tccatcgttt       540
     ccgtatcgcc tcgcgcatat gaccattgcc gcgttcatcg tggcgggctt catcgttgcc       600
     gcttgcggcg cgtggcatct gttgcagggg cggcgcgaca aacccgtcac gcgtagtttt       660
     tcgatggcgc tatggattct gcttttcctc acgccgatac agatcttcgt cggcgatgcg       720
     catggtctga acacacgcga atatcagccg gccaagatcg ccgcgatcga agggttgtgg       780
     gaaaccgaga agggcggcac ggcgctgaac ctggtcggtc tgcccgacat ggatgcggaa       840
     gtgacgcgat atacgctgca agtgccgcat ctgggcagcc ttatcctgac gcacagctgg       900
     gacggagaaa ttcgcggcct gaaggaattt cccccgcagg accgcccgta ttcgccgatc       960
     gtgttctgga cgttccggat catggcgggt ctgggcatgc tgatgctatt gaccacgctg      1020
     ctcggcctcg tgctcagagt gcgcggccgc ctctacgaga cgcggtggtt tcagcgtttc      1080
     gttctgtgca tggggccttc gggaatcgtg gcgttgctgg ccgggtggat aaccacggaa      1140
     gtcggccgtc aaccctggac ggtgtacggc gttctgcgca cagcggactc tgtgtcgccg      1200
     atcggttccc agcaagcggg cgtttcattg ctgatcttcg tgatggtgta cttcctggta      1260
     ttcggcatgg gcttctacta catgatgaaa atgatgaagc gcggaccgga agagcatgtc      1320
     gagcgccgtg attcacgcag gcatccggtc ctgcgcaatc gcccgctgga tgcactggaa      1380
     ggggagtga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page