(data stored in ACNUC7421 zone)

EMBL: CP000270.PE626

CP000270.PE626       Location/Qualifiers
FT   CDS_pept        complement(711716..712519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3834"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29164"
FT                   /db_xref="GOA:Q144S5"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S5"
FT                   /protein_id="ABE29164.1"
FT                   /translation="MNNLHRELAPISRAAWSQIEDEVARTFRRSVAGRRVVDVKGPGGT
FT                   ELSGVGTGHQTAIAAPQQGVVAKLSEVKSLVELTVPFELQREAIDSVVRGAKDADWQPA
FT                   KEAAKQLAYAEDRAIFDGYQAAGIGGIREGSSNPSLALPADVSDYPNAISNALEQLRLA
FT                   GVDGPYSVLLGADAYTALGEARDQGYPVIEHIKRIVNGDIIWAPALAGGSVLSTRGGDF
FT                   ELHLGEDLSIGYTSHTDTVVRLYLRETLTFLMLTSEASVSVTQAE"
     atgaataacc tgcatcgcga gctcgccccc atctcccgtg cggcctggtc gcagatcgaa        60
     gatgaagtgg cgcgcacctt caggcgcagc gtcgccggcc gtcgcgtggt cgacgtgaag       120
     ggccccggcg gaacggaact ctccggcgtc ggcaccgggc atcagaccgc gatcgcggcg       180
     ccgcagcagg gcgtcgtcgc gaaactgtcc gaggtgaaga gcctcgtcga attgaccgtg       240
     ccgttcgaat tgcagcgcga ggcgatcgac agcgtggtgc gcggcgcgaa agatgccgac       300
     tggcaacccg ccaaagaagc agcaaagcaa ctcgcctacg ccgaagatcg cgcgatcttc       360
     gacggctatc aggcagccgg catcggcggg attcgcgaag gctcgtcgaa cccttcgctt       420
     gcgctgccgg ccgacgtcag cgactatccg aacgccatca gcaacgcgct cgaacaactg       480
     cgtctcgccg gcgtggacgg cccgtattcc gtcctgctgg gcgccgatgc gtacaccgca       540
     ctgggtgagg cacgcgacca gggctacccg gtcatcgagc acatcaagcg gatcgtgaat       600
     ggcgacatca tctgggcacc ggcgctcgcc ggcggcagcg tgctgtccac gcgcggcggc       660
     gacttcgagc ttcacctcgg cgaagatctg tcgatcggct acacgagcca tacggacacc       720
     gtggtgcgtc tctatctgcg cgaaacgctg acgttcctga tgctgacgag cgaagcatcg       780
     gtttcagtga cgcaggcgga ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page