(data stored in ACNUC7421 zone)

EMBL: CP000270.PE628

CP000270.PE628       Location/Qualifiers
FT   CDS_pept        713767..714033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3832"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29166"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S3"
FT                   /protein_id="ABE29166.1"
FT                   /translation="MTARRSWRSRFSQILYRCGTLWKLHKGIGVQFPYACLVDTAWRYH
FT                   DCFPILDIGIRSFLFSVTWLLKCIAPDSGSERGRVAGSRTENV"
     gtgactgcac gacgaagttg gcgttcacga ttttcacaga tcttataccg ctgcggcact        60
     ttatggaaac tccataaagg cattggcgtt caatttccat atgcatgtct tgtcgatacc       120
     gcatggcgat accacgactg ctttccgata cttgatatcg gaatccgcag cttcttattt       180
     tctgtcacat ggttattaaa atgcattgcg ccggacagcg ggtccgaacg cgggcgcgtt       240
     gctggatccc gcacggaaaa cgtgtag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page