(data stored in ACNUC7421 zone)

EMBL: CP000270.PE629

CP000270.PE629       Location/Qualifiers
FT   CDS_pept        714092..714532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3831"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29167"
FT                   /db_xref="GOA:Q144S2"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S2"
FT                   /protein_id="ABE29167.1"
FT                   /translation="MTLPADEHLTRQTIEGFYRAIEQKSVALLRQVVTPDWEYIPEPVG
FT                   AAAGPDQMVQFFENIAKAIPDMKVTILDVLVHGDRVGVRAEISGTQTGTLLGIAASSKH
FT                   IRFAIHSFHQMRGNLIAKTWHLEDWLSVFRQLGALPQTLERS"
     atgaccctgc ccgccgacga acatctcact cgtcaaacga tcgaagggtt ctatcgcgcc        60
     atcgagcaga agagcgtcgc attgctgcgg caggtcgtca ccccggactg ggaatatatt       120
     cccgagcccg tcggggctgc cgcgggaccc gaccagatgg tgcagttctt cgagaacatc       180
     gctaaagcaa ttcccgacat gaaagtcact attctcgacg tgctcgttca tggcgatcgg       240
     gtgggcgtgc gcgcggaaat cagcggcact caaaccggga cattacttgg cattgccgcg       300
     agttccaaac acatcagatt cgcgattcac tctttccacc agatgcgcgg aaatctgatt       360
     gcgaaaacat ggcacctgga agattggctg tctgtgttcc ggcaacttgg ggcgttaccc       420
     cagactcttg agcggtcgtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page