(data stored in ACNUC7421 zone)

EMBL: CP000270.PE632

CP000270.PE632       Location/Qualifiers
FT   CDS_pept        complement(718165..719250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3828"
FT                   /product="Conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29170"
FT                   /db_xref="GOA:Q144R9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R9"
FT                   /protein_id="ABE29170.1"
FT                   /translation="MSTPQRRSASTPLMPESGALPPPAKPGVETGLVRIAPGLLGKTSR
FT                   LRSVMVWVVGVMGCIAVILVVLHLGSLQKMAELIRSARPGWMLVALAVQCGTYVSAAFV
FT                   WRQTLREAGHPLSLRTLTPLGIAKVFTDQVLPSGGISGTMLVVRGLTGRHVPAGIAMAA
FT                   MLVGMVSYDIAYLLVVLASAGMLWWQHRLNTALVIGVAVFVVVTVAVPAAVLGLKQWGQ
FT                   RAPIAWLSKWLGVTTLLRQLTDAPTHLLRSPRLLLQTVGLQLAIFVCDALTLWLAFNAI
FT                   GEVPPLWVVFVSFIIASMVATIGPIPVGLGTFEATSVGMLNLLGVSVEAALAATLLLRA
FT                   LTFWLPMLPGIWLARREIRLH"
     atgagcactc cgcagcgccg ctccgccagc accccgctca tgccggaaag cggcgcgttg        60
     ccgccgccgg cgaagcctgg cgtcgagacc ggcctcgtgc gtatcgcgcc tggcctgctc       120
     ggcaaaacat cgcggctgcg ctcagtcatg gtctgggtcg tcggagtgat gggctgtatc       180
     gccgtcatcc tggtggtgct gcacctcggc tcactgcaga agatggccga actgatacgc       240
     tcggcgcgcc ccggctggat gctggtcgca ctcgccgttc aatgcggcac gtatgtcagc       300
     gcggcgttcg tatggcgcca gactttgcgc gaggccggac atcctctgtc cctgcgcacc       360
     ttgacaccac tcggcatcgc caaggtattc acggatcagg tgttgccgag cggcggcatc       420
     agcggcacga tgctggtggt gcgtggcctg accggccggc acgtcccggc cggaatagcg       480
     atggcggcca tgctggtcgg catggtgtcc tacgacatcg cctatctgct cgtggtgctc       540
     gcaagcgccg gcatgctgtg gtggcagcac cggctgaaca cggcattggt catcggcgtg       600
     gcggtcttcg tagtggtcac cgtagcggtg ccggccgccg tgctgggact caaacaatgg       660
     ggccaacgtg cgccgatcgc gtggctcagc aagtggctgg gcgtcaccac actgcttcga       720
     caattgaccg acgcgcccac tcatcttcta cgcagcccgc gcctgctact gcaaactgtc       780
     gggctgcaac tggccatctt cgtctgcgat gccctgacgc tctggctcgc gttcaatgcg       840
     atcggcgaag tgccgccgct ttgggtcgtg ttcgtgagct tcatcattgc gtcgatggtg       900
     gccaccatcg gtccgattcc ggtcggcctg gggaccttcg aagccacctc cgtgggaatg       960
     ctgaatctgc tcggcgtgtc ggtggaggcg gcgctcgccg ccacgcttct gttgcgcgcg      1020
     ctgaccttct ggctaccgat gctgcccggc atctggctgg ctcgccggga gattcggctt      1080
     cattag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page