(data stored in ACNUC7421 zone)

EMBL: CP000270.PE633

CP000270.PE633       Location/Qualifiers
FT   CDS_pept        complement(719400..719963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3827"
FT                   /product="Putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3827"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29171"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R8"
FT                   /protein_id="ABE29171.1"
FT                   /translation="MYKRILVAIDGSETSGHAFDTALQLARDNGAQLQPLYVIDNPLMA
FT                   YDASGYDPTALRDASMQEGRQLLADALARMKHENVAGEPRIVDVAPIGEDISERIRISA
FT                   NEFNADLLVLGTHGRRGFKRLFLGSVAERVVRSASLPVLLVPSRQAQTTVVQAARPGHA
FT                   DVAAAMYELPVSGGHVHGGDAQPQ"
     atgtataaac gcattctggt ggcgatcgat ggcagcgaga cgtctggaca tgcgttcgac        60
     accgcgttgc aactcgctcg cgacaacggc gcgcagttgc aaccgctcta tgtcatcgac       120
     aacccgttga tggcatacga cgcgtccggc tacgatccga ccgccttgcg cgatgcctcc       180
     atgcaggaag gccggcagtt gctggcggat gcactggcgc gcatgaaaca tgagaacgtg       240
     gccggcgagc cgcgcatcgt cgacgtcgcg ccgatcggcg aagacatctc ggagcggatc       300
     cgcatttcgg ccaacgaatt caatgcggac ctgctggtgc tcggcacaca cggacgacga       360
     ggtttcaagc gactgtttct aggcagcgtg gccgagcgcg tggtacgcag tgcgagcctg       420
     ccggtattgc tggtgccgag ccggcaagcg cagaccacgg tcgtgcaggc cgcgagaccg       480
     ggacacgccg acgtcgccgc ggcgatgtac gaattgcccg ttagcggcgg ccacgtgcat       540
     ggtggcgacg cccagccgca atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page