(data stored in ACNUC7421 zone)

EMBL: CP000270.PE636

CP000270.PE636       Location/Qualifiers
FT   CDS_pept        complement(723373..723924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3824"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3824"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29174"
FT                   /db_xref="GOA:Q144R5"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R5"
FT                   /protein_id="ABE29174.1"
FT                   /translation="MTPYDVVIAVFDDHHNADAAVRKLIDGGFDMKNFSVIGKGYHTEE
FT                   KIVGLYTVGDRMKMWGKYGAFWGGLWGLLMGGVFLTIPVLGPVVVLGHLAVMIVSAVEG
FT                   AVVVGALSALGATLVHMGLPKDSVIHYEAAIKADGFIVMGHGTPDEMARAKAVLALHQP
FT                   TRLDSHEGLTPAEPSTHETA"
     atgactccct atgatgtcgt aatcgcggtc ttcgatgacc accataatgc cgacgccgcc        60
     gtgcgcaagc tgatagacgg cggcttcgac atgaagaatt tcagtgtgat cggcaagggt       120
     tatcacaccg aggaaaagat cgtcggtctc tacacggtcg gcgaccgcat gaaaatgtgg       180
     ggcaaatacg gcgcgttctg gggcggcctg tggggcttgc tgatgggcgg cgtattcctg       240
     acgattccgg tgctcggccc ggtcgtcgtg ctgggtcatc tcgccgtcat gatcgtgtcg       300
     gctgtcgaag gggcggtcgt tgtaggcgcc ctcagtgctt tgggtgcaac gctcgtgcat       360
     atggggctgc cgaaggacag cgtgatccat tacgaggccg ccatcaaggc cgacggattc       420
     atcgtgatgg gtcacggcac gcccgacgaa atggcgcgcg caaaggccgt tctcgcgctc       480
     catcaaccca cgcgcctcga ttcgcacgaa ggcctcacgc ccgccgaacc ctccacgcac       540
     gaaaccgcct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page