(data stored in ACNUC7421 zone)

EMBL: CP000270.PE64

CP000270.PE64        Location/Qualifiers
FT   CDS_pept        complement(80670..81713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4398"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28602"
FT                   /db_xref="GOA:Q146Y7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y7"
FT                   /protein_id="ABE28602.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
     atgttcggtt ttttgcgcag ctacttctcc aacgatctgg ccattgacct cggcacggcc        60
     aacacgctca tctacatgcg tggcaagggc atcgttcttg atgaaccgtc ggtggtctcg       120
     atccgtcagg aaggcggtcc caacggcaag aaaaccattc aggcagtcgg caaggaagcc       180
     aagcagatgc tcggcaaggt gccgggcaac atcgaggcga tccgccccat gaaagacggc       240
     gtgatcgccg acttcaccgt caccgagcaa atgatcaagc agttcatcaa aactgctcac       300
     gaatcgcgca tgttctcgcc gtcgccgcgc atcatcatct gcgtgccgtg cggttcgacc       360
     caggtcgaac gccgcgcgat caaggaagcc gcgcacggcg cgggcgcttc gcaggtctac       420
     ctcattgaag aaccgatggc ggccgccatc ggcgccggcc tgccggtgtc ggaagcaacc       480
     ggctcgatgg tcgtcgacat cggcggcggc acgaccgaag tcggcgtgat ctcgctcggc       540
     ggcatcgttt ataaaggctc ggtgcgcgtg ggcggcgaca agttcgacga agccatcgtc       600
     aactacatcc gccgcaacta cggcatgctg atcggcgagc aaacggccga agccatcaag       660
     aaggaaatcg gctccgcctt cccgggttcc gaagtcaagg aaatggaagt gaagggccgc       720
     aatctgtcgg aaggcattcc gcgcagcttc acgatctcca gcaacgaaat tctcgaagcc       780
     ctcaccgatc cgctgaacca gatcgtgtcg tcggtgaaga tcgcgctcga acagacgccg       840
     ccggaactcg gcgcggacat cgccgagcgc ggcatgatgc tcacgggcgg tggcgcgctg       900
     ttgcgcgatc tggaccgcct gctcgccgaa gaaaccggcc tgccggtgct cgtcgccgaa       960
     gacccgctga cctgcgttgt gcgcggctcg ggcatggcgc tcgaacgcat ggacaagctg      1020
     ggcagcatct tctcgtacga gtaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page