(data stored in ACNUC7421 zone)

EMBL: CP000270.PE640

CP000270.PE640       Location/Qualifiers
FT   CDS_pept        726573..727292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3820"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29178"
FT                   /db_xref="GOA:Q144R1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R1"
FT                   /protein_id="ABE29178.1"
FT                   /translation="MAQGHQENENHLLAVLPDLEWERLAPHLVLMDMPLGNVVYESGDR
FT                   LNYVYFPTTCIVSLLYVMEDGASAEIAIVGNEGLIGIALFMGGETTPSRAVVQSAGKAY
FT                   RLDAQILKEEFHRAGPVQRLLLRYTQALITQMAQTAVCNRHHSIDQQLCRWLLLSIDRL
FT                   SSNELKMTQELIANMLGVRRSGVTEAALKLQDAGLIRYSHGHIEVQDRPGLEKRVCECY
FT                   GVVKREFDRLLPALKAL"
     atggcccaag gtcatcagga aaacgaaaat catctgctgg ccgtgctgcc cgacctggag        60
     tgggagcgtt tggcgccaca tcttgtgctc atggatatgc cgttgggcaa cgtcgtctac       120
     gaatcgggcg atcgcctcaa ttacgtgtat ttcccgacca cctgtatcgt gtcgctgctg       180
     tacgtgatgg aggacggtgc ttccgccgaa atcgcgattg tcggcaacga ggggcttatt       240
     ggcatcgcgc tgttcatggg tggcgagacc acgcccagcc gggcggtcgt gcagagcgcc       300
     ggcaaggcgt atcggctgga cgctcaaatc ctgaaagaag aatttcatcg cgcgggcccc       360
     gtgcagcgcc ttctgcttcg ctatacgcag gcgctgatca cgcagatggc gcagaccgcc       420
     gtgtgcaatc gacaccattc gattgaccag cagttgtgca ggtggcttct gctcagcatt       480
     gaccgcctgt cttcaaacga attgaagatg acccaggaac tgatcgccaa tatgctgggt       540
     gtgcgccggt ccggggtaac cgaggccgcg ctgaaattgc aggacgcggg gttgattcgc       600
     tacagtcacg gccacatcga ggtacaggac agaccggggc tcgaaaaacg tgtgtgcgaa       660
     tgttatggcg tggtgaagcg cgaattcgac cggttgttgc ctgctttgaa agcgttataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page