(data stored in ACNUC7421 zone)

EMBL: CP000270.PE641

CP000270.PE641       Location/Qualifiers
FT   CDS_pept        complement(727439..727879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3819"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29179"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R0"
FT                   /protein_id="ABE29179.1"
FT                   /translation="MLRVASLQEDNRMINEADLDMDAHDLNPAALERALRSASLDLQQI
FT                   IATVAGRYLDSGRRRYSSGARSPTWRTLLTIDEQVFENRGFRARHNEAVRSTFVRFGDS
FT                   RLSGVDLDEPVDWKRDDDDLPAVYLLVRALVQADATDMATQD"
     atgctgcgag ttgcgagtct tcaggaagat aaccgtatga ttaacgaggc tgatctcgat        60
     atggacgccc atgacctcaa ccccgctgcc ctcgaacgcg cactccgcag cgcgtcgctc       120
     gacctccagc agatcatcgc cacggtcgcc ggtcgttatc tcgacagtgg ccgtcgccgt       180
     tactcaagtg gcgcgcgatc gcccacgtgg cgcacgctgc tgacaatcga cgaacaggtc       240
     tttgagaatc ggggcttccg ggcaaggcac aacgaggccg tacgctcaac gtttgtccgg       300
     tttggcgaca gtcgcttgtc cggggtggat ctcgacgaac ccgtcgactg gaaacgtgac       360
     gacgacgacc tgccggccgt gtacctgctc gtgcgtgccc tggtacaagc cgacgctacc       420
     gatatggcca ctcaggacta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page