(data stored in ACNUC7421 zone)

EMBL: CP000270.PE643

CP000270.PE643       Location/Qualifiers
FT   CDS_pept        728243..728653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3817"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29181"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q8"
FT                   /protein_id="ABE29181.1"
FT                   /translation="MAEKEDGGQGRCAIGGRASSGGRRTSTVPRGARWAVYKDHESSGP
FT                   HDIGSAAIGGGVASATVGSGVSGDARERISVRAGTNQFMVIAPTTNKSSKGFPWTAGPT
FT                   TPDERTPPDRALRRTVVWPYCACDVANRWVLL"
     atggcggaga aagaagacgg cggtcaaggt cgatgcgcaa ttggtggtag ggcaagcagc        60
     ggcggccggc gcacttctac cgtgccgcgc ggcgcgagat gggcggtcta taaagaccat       120
     gaaagttccg gcccgcatga catcgggagc gcagcgatcg gcggtggcgt ggcatcagca       180
     actgtggggt ctggagtgag cggtgacgct cgagagcgca tctcagtgag ggcgggcact       240
     aaccaattca tggtcattgc accgacgacg aacaaatcga gtaaggggtt tccctggacg       300
     gcgggaccta ctactccgga cgaacgaacg ccgccagata gggcgttgcg ccgcactgtg       360
     gtgtggccgt actgtgcatg cgatgtcgcg aataggtggg ttctgctata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page