(data stored in ACNUC7421 zone)

EMBL: CP000270.PE646

CP000270.PE646       Location/Qualifiers
FT   CDS_pept        complement(731091..731951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3814"
FT                   /product="Putative hydroxymethylpyrimidine kinase"
FT                   /EC_number="2.7.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29184"
FT                   /db_xref="GOA:Q144Q5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q5"
FT                   /protein_id="ABE29184.1"
FT                   /translation="MPSDTPPIVLTFGLSDPTGGSGLQADLMTLASMGCHGVSVLTGYT
FT                   VRDSASCDEVTGLDPEVVATQARMLLEDMPIAAFKVGACTRAEVVSAIAEVVADYDDIP
FT                   LILAPDFTLDDEHVLSADELREAIADLLAPQTTLLVADATTLLALAQPDGDAEAPSLDA
FT                   AISHLLSQGCEYILSTETGTHRHVNTLFSEDGQLRQDMWDRGSHRIMGLTDTLGSAIAA
FT                   LLANGQEPAEAVREAQEYLYQAVRNAFRPGMGAYMPDRFFWARSSDDETPPAAGKDAAP
FT                   GEARH"
     atgcccagcg acacgcctcc gatcgtcctc accttcggcc tttccgatcc caccggcggc        60
     tccggcctgc aagccgacct gatgaccctt gccagcatgg gctgccacgg cgtctccgtg       120
     ctcacgggct acaccgtgcg cgactcggcg agctgcgacg aagtcaccgg actcgacccc       180
     gaagtggtcg cgacccaggc ccggatgctg ctcgaagaca tgccgatcgc cgcgttcaag       240
     gtgggcgcct gcacgcgcgc ggaagtcgtg agcgcgattg ccgaagtcgt cgccgattac       300
     gacgacattc cgctgattct cgcccccgac ttcacgctcg acgacgagca cgtgctctcc       360
     gccgacgaac tgcgcgaagc gatcgccgat ctgctcgcgc cgcaaaccac cctgctggtc       420
     gccgacgcga ccacgctgct cgcgctcgct caaccggacg gcgacgccga agcaccgagc       480
     ctcgacgccg cgatctcgca tctgctgtcg caaggctgcg aatatattct gtcgacggaa       540
     accggcacgc accggcatgt caacacgctg ttcagcgaag acggccagtt gcgccaggac       600
     atgtgggacc gtggcagcca tcggatcatg gggctgacgg atacgctggg gtcggccatc       660
     gccgcgttgc tggccaacgg ccaggagccg gctgaagccg tgcgcgaggc gcaggagtat       720
     ctgtatcagg ccgtgcgcaa cgcgttccgg ccgggcatgg gcgcgtatat gccggaccgg       780
     ttcttctggg cgcgcagcag cgatgacgaa acgccgccgg ccgccggcaa ggacgcagca       840
     ccaggcgaag cgcgccactg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page