(data stored in ACNUC7421 zone)

EMBL: CP000270.PE650

CP000270.PE650       Location/Qualifiers
FT   CDS_pept        734946..735386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3810"
FT                   /product="Conserved hypothetical protein 250"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3810"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29188"
FT                   /db_xref="GOA:Q144Q1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144Q1"
FT                   /protein_id="ABE29188.1"
FT                   /translation="MSLAAGREATLLAFDYGEKRIGVAVGNSLTKSARPLVIVQNRSRE
FT                   YRFEAVGKLIAEWKPNALVVGLPMHPDGTPHEMTQLAKRFGNQLNGRFNLPVTWIDERY
FT                   SSVEAKAEIRAGNGRADMLDAEAASIILQQYLDGLSDDHEFH"
     atgagcctgg ccgccggacg tgaggcgacg ctgcttgcgt tcgactacgg tgaaaaacgc        60
     atcggcgtgg cggtcggcaa ttcactgacg aagagcgcgc ggccgctcgt gatcgtgcag       120
     aaccgcagcc gcgaataccg gttcgaagcg gtcggcaaac tgatcgccga gtggaagccg       180
     aacgcgctgg tggtcggctt gccgatgcat ccagacggta cgccgcacga aatgacacaa       240
     ctcgcgaagc gcttcggcaa tcagctgaac ggccgcttca atctcccggt cacgtggatc       300
     gacgaacgct attcgtcggt cgaggcgaag gcggagatcc gcgccggcaa cggccgcgcc       360
     gacatgctcg acgccgaagc cgccagcatc atcctccagc agtatctaga cggactttcc       420
     gacgatcatg agttccattg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page