(data stored in ACNUC7421 zone)

EMBL: CP000270.PE67

CP000270.PE67        Location/Qualifiers
FT   CDS_pept        84079..85554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4395"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28605"
FT                   /db_xref="GOA:Q146Y4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Y4"
FT                   /protein_id="ABE28605.1"
FT                   /translation="MTKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLA
FT                   LPGTLPVMNRGAVERAIQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQVTIQVPANEKANTPAYEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKTLHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAE
FT                   IKNLNSFRFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIDAAWVERVKSEMPELPVAIQQRFVTQYGLTPYDANVLTSSKAMAAYYE
FT                   AVVSKLGPANAKAAANWLMGEVSSQLNREDLDIAASPVSSAQLALLLQRIADGTISHKI
FT                   AKEIFLSIWEEKATDEAATDRIIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPAQVNELLRKKLS"
     atgaccaagc aatgggaagt cgtgatcggt ctggagaccc acgcgcaact gtcgacccac        60
     tcgaagattt tttcgggcgc ctcgacgcaa ttcggcgctg cgccgaatac gcaggcctgc       120
     cccgtcgatc tggcgttgcc gggcacgttg ccggtgatga accgcggcgc cgtggagcgc       180
     gcaatccagt tcggcctcgc gatcggcgcg acagtggcgc cgcgcagcat cttcgcgcgc       240
     aagaattatt tctaccccga tctgcccaag ggctaccaga tcagccagta cgaaatcccc       300
     gtcgtgcagg gcggccaggt gacgattcag gtgccggcca atgaaaaggc gaatactccg       360
     gcgtacgaaa aggtcgtcaa cctcacgcgc gcccacctcg aagaagacgc gggcaagtcg       420
     ctgcacgaag acttcgcggg catgaccggc atcgacctga atcgcgccgg cacgccgctg       480
     ctcgaaatcg tcaccgagcc ggaaatgcgc agcgcggcgg aagcggtcgc ctacgcgaag       540
     acgctgcata cgctcgtcac gtggctcggt atctgcgacg gcaacatgca ggaaggctcg       600
     ttccgctgcg acgcgaatgt atcggtgcgt ccggtcggtc aggcggaatt cggcacgcgt       660
     gccgagatca agaacctgaa ctcgttccgc ttcctcgaag aagcgatcca gtacgaagtg       720
     cgccgtcaga tcgaactgat cgaagacggc ggcacggtgg tgcaggaaac gcgtctgtac       780
     gatccggaca agcgcgaaac gcgctccatg cgcagcaagg aagacgcaca cgattaccgc       840
     tatttccccg atcccgatct gatgccgctc gtgatcgacg cggcgtgggt cgagcgcgtc       900
     aaaagcgaaa tgccggaact gccggttgcg attcagcagc gcttcgtcac gcaatacggt       960
     ttgacgccgt acgacgccaa cgtgctgacg tcgagcaagg caatggcggc gtactacgaa      1020
     gcggtggtga gcaagctcgg cccggccaac gccaaggccg cggcgaactg gctgatgggc      1080
     gaagtgtcgt cgcaactgaa tcgcgaggac ctcgacatcg ctgcgagccc ggtatcgtcc      1140
     gcgcaacttg cgctgctgct acagcgtatc gcggacggca cgatctccca caagatcgcc      1200
     aaggaaattt tcctgtcgat ctgggaagag aaagccaccg acgaagccgc caccgatcgc      1260
     atcatcgaag cgaaaggcct gaagcagatt tcggataccg gcgcgctgga agcgatcatc      1320
     gacgaagtgc tcgccgcgaa tcagaagtcg gtcgaggaat tccgcgccgg caaggaaaag      1380
     gcgttcaacg cgctgatcgg ccaggccatg aaggcgacca agggcaaggc caatccggcg      1440
     caggtgaacg aactgctcag gaagaagctg tcctga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page