(data stored in ACNUC7421 zone)

EMBL: CP000270.PE70

CP000270.PE70        Location/Qualifiers
FT   CDS_pept        complement(87454..88254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4392"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28608"
FT                   /db_xref="GOA:Q146Y1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y1"
FT                   /protein_id="ABE28608.1"
FT                   /translation="MRYGGYLVFRNLIPSPMLEAQAAEEFNQIAYGAEHANRLYGDTDA
FT                   HVTRVRSIVDKLIPYSLKWNERAKNWKWDVAVVRSTDIRMYCLPGGKIVVYGGLLDRAR
FT                   LNDNELGMLIGHEIAHALREHARERLGQLQASQLDSSGTIPQLFGLADLGAAPLGIGSR
FT                   LLEMKYENTDETEADVIGSDIASRAGFDPRAAVTLWDKLAQATRGNREQGFIYVHPYTS
FT                   ARRQDIVKRLPDMLPLYAKAIGKTVDTLPDYAGMGRPRRKPVRD"
     ttgcgctacg gcggctacct ggtgttccgc aacctgatcc catcgccgat gctcgaggct        60
     caagccgccg aagagttcaa ccagatcgcg tacggcgccg agcacgccaa ccgtctgtac       120
     ggcgacaccg atgcgcatgt cacgcgcgtg cgctcgatcg tcgacaagct gatcccgtac       180
     tcgctgaaat ggaacgagcg ggccaaaaac tggaagtggg atgtagcggt ggtgcgctcg       240
     accgatatcc gcatgtactg cctgccgggc ggcaagatcg tcgtatatgg cggcctgctc       300
     gaccgcgcgc gtctgaacga caacgaactc ggcatgctga tcggccatga gatcgcgcac       360
     gcgctgcgcg aacatgcacg cgagcggctc ggccagttgc aggcgagcca gctcgactcg       420
     tccggcacga tcccgcagct attcgggctc gccgatctcg gcgcggcgcc gctcggcatc       480
     ggctcgcgcc tgctggaaat gaagtacgag aataccgacg agaccgaagc cgatgtgatc       540
     ggcagcgata tcgcgtcgcg cgccggcttc gatccgcgcg cggcggtcac gctctgggac       600
     aagctcgcgc aggccacgcg cggcaaccgc gagcagggct tcatctacgt gcatccctac       660
     acgtcggcgc gccgccagga catcgtcaag cgcttgcccg acatgctgcc gctctatgca       720
     aaagcgatcg gcaaaacagt ggacacgttg ccggattacg ccggcatggg ccgtccgcgc       780
     cgcaaaccgg tccgcgattg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page