(data stored in ACNUC7421 zone)

EMBL: CP000270.PE73

CP000270.PE73        Location/Qualifiers
FT   CDS_pept        complement(90110..90718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4389"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28611"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X8"
FT                   /protein_id="ABE28611.1"
FT                   /translation="MNQRALDYLALRPDFRAIARWVEPRATVLDLGCGDGSLLSLLSEE
FT                   LDVLGYGIEINDAGVLASTQNGVNVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAA
FT                   ILRETVRVGKECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIEDFEA
FT                   LAPEVGIEILDRVVLHEGQVVRWGVNWRGSLAVYRVKKS"
     atgaaccagc gagccctgga ctatctggcg ctgcgcccgg acttccgcgc gatcgcccgc        60
     tgggtcgaac cgcgcgccac cgtgctggat ctgggctgcg gcgacggctc gctgctctcg       120
     ctgctgagcg aagaactgga cgtgctgggc tacggcatcg agatcaacga cgcgggcgtg       180
     ctggcgtcga cgcaaaacgg cgtcaacgtg atccagcaga atctggaaga cggtctgcgc       240
     ctgttcgaag acggcagctt cgatttcgcg attctgtcgc agacgctgca aaccattcac       300
     cagacggccg cgatcctgcg cgagaccgtg cgggtcggca aggagtgcat cgtgtcgttc       360
     ccgaacttcg gctactgggc gcatcggctc tcggtgctcc ggggccgcat gccggtgtcg       420
     aagtcgctgc cttatcagtg gcacaacacg ccgaacgtgc gggtgctgac catcgaggat       480
     ttcgaggcgc tcgcgccgga agtcggcatc gaaattcttg accgcgtagt gctccacgag       540
     ggtcaggtgg tgcgctgggg cgtgaactgg cgtggtagtc ttgcggtcta tcgcgtcaag       600
     aaaagctaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page