(data stored in ACNUC7421 zone)

EMBL: CP000270.PE77

CP000270.PE77        Location/Qualifiers
FT   CDS_pept        complement(93865..94764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4385"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28615"
FT                   /db_xref="GOA:Q146X4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X4"
FT                   /protein_id="ABE28615.1"
FT                   /translation="MSELPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKMLMPDRDNPGQYVDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDGLFADGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
     atgtccgagc ttcccgacct ttcgcagatt gcgcccaccc tgaaggctga aatcctggcc        60
     gaggcgctgc cctacattcg ccagtatcac ggcaagaccg tggtcatcaa atacggcggc       120
     aacgccatga ccgaagagcg tctgaagcag ggcttcgcgc gcgacgtgat cctgctgaag       180
     ctggtgggca tcaatccggt catcgtgcac ggcggcggtc cgcaaatcga ccaggcgctg       240
     aagaagatcg gcaaacaggg caccttcatc cagggcatgc gcgtcaccga cgaagaaacg       300
     atggaagtcg tcgaatgggt gctcggcggc gaagtgcagc aggacatcgt cacgctgatc       360
     aaccacttcg gcggtcacgc ggtcggcctg acaggcaaag acggcggcct gatccacgcc       420
     cgcaagatgc tgatgccgga tcgcgacaat ccgggccagt atgtcgatat cggccaggtg       480
     ggcgaagtcg aggcgatcaa cccggcggtc gtgaaagcgc tgcaggacga cgcgttcatt       540
     cccgtcatct cgccgatcgg gttcggcgaa gacggcttgt cgtacaacat caacgcggac       600
     ctggtcgcgg gcaagctggc ggtggtgctg aacgccgaaa agctggtcat gatgaccaac       660
     atccccggcg tgatggataa ggaaggcaat ctgctcaccg atctgtccgc gcgcgaaatc       720
     gacggcctgt tcgcggacgg cacgatctcc ggcggcatgc tgccgaaaat ctcgtcggcg       780
     ctggacgcgg ccaagagcgg cgtgcggtcg gtgcacatca tcgacggccg catcgagcac       840
     tcggtgctgc tggaaattct caccgaacag ccgttcggca cgatgatccg ctcacattga       900
//

If you have problems or comments...

PBIL Back to PBIL home page