(data stored in ACNUC7421 zone)

EMBL: CP000270.PE78

CP000270.PE78        Location/Qualifiers
FT   CDS_pept        complement(95295..96935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28616"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X3"
FT                   /protein_id="ABE28616.1"
FT                   /translation="MLPTSSGEADASSAFLTVLREAAAARHDGTAQTEAGCLDAAARLH
FT                   PLDDASLASLTATLLEQHRLGDAIELAAIIAQLDPHRALAHFRHGYALQIANRHGEAIA
FT                   PYRRALAIDPRLPCLRSNLAGALAHVGGDLNEQIALLECAVRDEPGEGDGWTNLTNAYR
FT                   MNRDLPRALEAGVKAVQCAPHSPLAHNNYALTLREAQRWSEAERAAQTACALGPNDPAL
FT                   RSNLSMLQLIRADYEHGWASHEARWDGSAELGGNRPVMPAPLWRGEPLAGKTLLVWGEQ
FT                   GMGDVLQFCRYIPMLAGRVHREGGRLVWNSFPQMGALLARSLGAHADEFSAGGGVESLP
FT                   AFDYEIPLLSLPLIFDTREETIPAATAPYLHADPAAIRSWQKRLAGESRLKVGLTWTGS
FT                   HSHQRNPFRRVGWERYAAYFGGMQDVAFYSLQPGATDEVAAARAAGLSMTDCTAEFTSF
FT                   DDTAAFVGALDLVITVCTSAAHLSGALGQRTWVLLDVNPHWVWLLDRRDSPWYPGATLY
FT                   RQPRFGEWEPALAAVARDLKALAGERRAA"
     atgctaccta cttcctccgg cgaggccgat gcctcatcag ctttcctgac tgttttgcga        60
     gaagccgcag cggcccggca cgacggcacg gcgcaaaccg aggccggctg tctcgacgcc       120
     gcagcgcgac tccatccact ggacgacgcg tcgctcgcat cgctcacggc tacgctgctc       180
     gaacaacacc gcctcggcga cgcaatcgaa ctcgccgcca ttattgccca actcgatccg       240
     caccgcgctc tggcgcactt tcgtcacggc tacgcattgc agatagcgaa ccggcatggc       300
     gaggccatcg caccttatcg ccgtgcactc gccatcgatc cgcgattgcc gtgtctgcgc       360
     agcaatctcg cgggtgcact ggcgcacgtc ggcggcgacc tgaacgagca gatcgcgctg       420
     ctggaatgcg cggtccgcga cgagcccggc gagggcgacg gctggaccaa tctgacgaac       480
     gcataccgca tgaataggga tctgccgcgc gcgctcgaag ccggcgtcaa agccgtgcaa       540
     tgcgcaccgc atagcccgct ggcgcacaac aactatgcgc tgacgctgcg tgaggcgcaa       600
     cgctggagcg aggcggagcg ggccgcccag actgcttgcg cattgggccc gaacgacccc       660
     gccctgcgct ccaacctgtc catgctgcaa ctcattcgtg ccgattacga gcacggctgg       720
     gcctcgcacg aggcgcgctg ggacggctcc gcggagttgg gcgggaaccg cccggtcatg       780
     ccggcgcccc tctggcgcgg cgaacctttg gccggcaaga cgctgctcgt ttggggcgaa       840
     caaggcatgg gcgacgtctt gcagttctgc cgctatatcc cgatgctcgc cgggcgagtg       900
     catcgcgaag gcggcaggct cgtctggaac tcgttcccgc aaatgggcgc actgctcgcg       960
     cgcagcctgg gcgctcacgc ggacgagttc tcggcgggcg gcggcgtcga atcgctaccc      1020
     gcgttcgact acgaaatccc gttgctcagc ctgccgctga tattcgatac gcgggaggaa      1080
     acgattccgg ccgccacggc gccctacctg catgcagacc cggctgcgat ccggtcgtgg      1140
     caaaaaaggc tggcgggcga atcgaggctc aaggtcgggc tgacatggac gggtagccac      1200
     agccatcagc gcaatccatt tcgccgtgtc gggtgggaac gctatgcggc gtatttcggc      1260
     ggcatgcagg acgtggcgtt ctattcgttg cagccgggcg caaccgacga ggtcgcggcg      1320
     gcacgagcgg ccggcctgtc aatgaccgac tgcaccgcgg aattcacgag cttcgacgac      1380
     accgccgcgt ttgtgggcgc gctcgatctc gtcatcaccg tttgcacgtc ggcggcgcat      1440
     ctgagcggcg cgctcggtca gcgcacctgg gtgctgctcg acgtcaaccc gcactgggtc      1500
     tggctgctcg accgtcgcga cagcccgtgg tatccgggcg ccacgctgta ccgccaaccg      1560
     cggttcggtg aatgggagcc ggcgctggca gcggtggcgc gtgatctgaa ggcattggcg      1620
     ggcgagcgcc gcgcggcatg a                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page