(data stored in ACNUC7421 zone)

EMBL: CP000270.PE79

CP000270.PE79        Location/Qualifiers
FT   CDS_pept        97065..98375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4383"
FT                   /product="Periplasmic Sensor Signal Transduction Histidine
FT                   Kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28617"
FT                   /db_xref="GOA:Q146X2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X2"
FT                   /protein_id="ABE28617.1"
FT                   /translation="MHRITNTGRVNLGHLFWLRSLAIIGQLMTIAFVQTFIGVQLPLPA
FT                   MLLVIALEVIFNGLTWWRVSQQRPESNMELFGQIWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMAWLAAFAVACYAVLGFDSVPLNLDNPANLFDYYRAGMWVNFMV
FT                   SVGLIAWFVARMSGALRLRDAALGDAQQRLLHDERAVALGVQAATVAHEIGTPLSTIAM
FT                   LSEELRDAARSDKGLAPYTADLELLEQQMALCTSALARLRSRASTSASRQPVGEWLESF
FT                   GEQWRLRHPHVKFERLGMPPAEVSLDDTVAVSQILTILLDNAARASRDHVTLSCSLAAR
FT                   GDQIVFEVCDAGSGIPAALRGSLGAMPVESTQGGHGVGLYLAFAAAARLKGSIELTDVS
FT                   AIKPRGTRAVLKLPLAARKFFGSGRHGAEPSNTEKQV"
     atgcatcgta taaccaacac tggccgcgtc aatctcgggc atctgttctg gctgcgcagt        60
     ctcgcgatca ttggccagct gatgacgatt gcgttcgtgc agaccttcat cggcgtgcag       120
     ttgccgttgc ctgccatgct gctcgtgatc gcgctcgaag tgatcttcaa tggactcaca       180
     tggtggcgcg tttcgcagca gcggcccgaa tccaacatgg agctgttcgg ccagatctgg       240
     gtcgatctgg gcgcgttgtc cgcgctgctg tttctctcgg gcggcaccac caatcctttc       300
     gtttcgctct acctgccctc tctcgcgatt gccgcggcgg tgctgccgtg gcatctgatg       360
     gcctggctcg cggcgttcgc cgtggcctgc tatgccgtgc tgggtttcga ttcggtaccg       420
     ctgaatctcg acaatcccgc gaacctgttc gactactatc gcgcgggcat gtgggtgaac       480
     ttcatggtca gcgtcggcct cattgcatgg ttcgttgcgc gcatgtcggg agcgctgcgg       540
     ctacgtgacg cagccctcgg agacgcgcag cagcgcttgc ttcacgatga acgcgcggtc       600
     gcattgggcg tgcaggccgc cactgttgct cacgaaatcg gtacgcctct gtctacaatt       660
     gcaatgttgt ccgaagaatt gcgcgacgcc gcacgctccg acaagggtct cgcgccatac       720
     acagccgatc tcgaactgct cgaacagcag atggcgctgt gtacttcggc gcttgcccgg       780
     ttgcgcagcc gggcttccac gagcgccagc cggcaaccgg tcggcgagtg gctcgagtcg       840
     ttcggcgagc agtggcgcct gcgtcatccg catgtgaaat tcgagcggct cggcatgccg       900
     cccgcggagg tcagtcttga cgataccgtg gccgtgagtc agattctcac gattctgctc       960
     gacaacgccg cgcgtgcaag tcgcgatcac gtcacgctgt cctgctcgct tgcggcgcgt      1020
     ggagatcaga tcgtattcga agtctgcgat gcgggctccg gcattccggc cgcgctgcgc      1080
     ggctcgctgg gggcgatgcc ggtcgagagt acgcaaggcg ggcacggcgt gggcctctat      1140
     ctggcttttg cggcggccgc gcgtctgaag ggatcgatcg agctgaccga tgtcagcgcg      1200
     atcaagccgc gcggtacgcg tgcggtcctg aaactgccgc tcgccgcgcg caaatttttt      1260
     ggctcgggcc gtcatggtgc cgagccatcc aacacggaga aacaagtatg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page