(data stored in ACNUC7421 zone)

EMBL: CP000270.PE81

CP000270.PE81        Location/Qualifiers
FT   CDS_pept        complement(99064..100410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4381"
FT                   /product="Heat shock protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28619"
FT                   /db_xref="GOA:Q146X0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X0"
FT                   /protein_id="ABE28619.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRTKAEDQAEDRILDILLPSARPVGFGASSGAADTVDEGSTTRQT
FT                   FRKRLREGLLDDKEVELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKMK
FT                   VKEALKALTDEEAARMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRNEAGGGEVSRQG
FT                   VQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSL
FT                   SVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYAVNEKTENIGARR
FT                   LYTVIEKLLEEVSFAAGNHSGRTVQIDAAYVDRALNEVAEDEDLSRYVL"
     atgagcacca tgacccctgc cgagatcgtc tcggaactcg acaaacacat catcggccaa        60
     ggccgcgcga agaaagcggt ggccgtcgcg ttgcgcaacc gctggcgtcg ccagcaggtc       120
     gaagagccgc tgcgtcagga aatcacgccg aagaacattc tgatgatcgg accgaccggc       180
     gtcggcaaga ccgaaatcgc gcggcgtctg gcaaaactcg cggacgcgcc gttcatcaag       240
     atcgaagcca ccaagttcac cgaagtcggc tacgtaggcc gcgacgtgga cagcatcgtg       300
     cgcgatctga tcgaaatctc ggtcaagcag acgcgtgaaa cggagatgcg caaggtgcga       360
     accaaggccg aagatcaggc cgaagaccgc atcctcgaca ttctgctgcc gagcgcgcgc       420
     ccggtcggct tcggcgcgag ttctggcgcc gctgataccg tggacgaagg cagcaccacg       480
     cgccagacct tccgcaagcg tctgcgcgaa ggcctgctcg acgacaagga agtcgagctc       540
     gacgtggaac agccgcaagt cggcatggac atcatggggc cgcccggcat ggaagacatg       600
     accgagcaga tccgttcgat gttcgcgaac atcggcggcg gcaagaaaac acgccgcaag       660
     atgaaggtga aggaagcgct aaaagcactc accgacgaag aagccgccag gatgctgaac       720
     gacgaagagg tgaaaaccaa ggcggtgcag aacgtcgagc agaacggcat tgtgtttctc       780
     gacgaaatcg acaagatcgc ctcgcgcaac gaagccggcg gcggcgaagt ctcccgtcag       840
     ggtgtgcagc gcgatctgct gccgctggtc gaaggcacca cgatcaacac caagtacggc       900
     atggtgaaga ccgatcacat tctgttcatt gccagcggcg catttcacct cgccaagccg       960
     agcgatctga ttccggagct gcaaggccgc tttccgattc gcgtcgaact ggactcgctg      1020
     tcggtgaacg atttcgaatc gatcctggtg tctacggatg cgagcctcgt caagcaatac      1080
     caggcattgc tcgccaccga agacgtgcat ctcgaattcg ccgacgacgg cattcggcgc      1140
     ctcgccgaaa tcgcgtacgc ggtcaacgag aaaaccgaga acatcggcgc gcgccgcctg      1200
     tacacggtga tcgaaaagct gctcgaggaa gtctcgttcg cggccggcaa ccactcgggc      1260
     cgcacggtgc agatcgacgc ggcctatgtc gatcgcgcac tgaacgaagt ggcggaagac      1320
     gaagatctgt cgcgttacgt gctgtga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page