(data stored in ACNUC7421 zone)

EMBL: CP000270.PE88

CP000270.PE88        Location/Qualifiers
FT   CDS_pept        complement(105930..106652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4374"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28626"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W3"
FT                   /protein_id="ABE28626.1"
FT                   /translation="MNDREVAEYLLANPEFFADHAEMLATIRLANPHGKAAVSLQERQM
FT                   EMLRDKNKHLERRLAELLRYGHENDSIASKFNRWTIRVIAERDPYALPRTIATGLRDIF
FT                   DVPQAALRVWDVAEPYTQADFARHVGEEVRIFAGSLTTPYCGANTGFEAAQWLAPSGAS
FT                   GGDESAAGQAGPESAHATESIALLALRDPEGNEEAPTFGLLVMGSPDARRFHEGMATDF
FT                   LTQIGALASAALSRLLPR"
     atgaacgatc gcgaagtcgc cgaatacctg ctcgccaacc ccgaattctt cgccgaccac        60
     gcggagatgc tcgcgacgat ccggctcgcg aatccgcacg gcaaagccgc ggtgtcgctg       120
     caggaacggc agatggaaat gctgcgcgac aagaacaagc atctcgaacg ccgcctcgcc       180
     gaactcctgc gctacggcca cgagaacgac agcatcgcgt cgaaattcaa ccgctggacc       240
     atccgcgtga tcgccgagcg cgatccgtac gcgctgccgc gtacgatcgc caccggcttg       300
     cgcgatattt tcgacgtgcc gcaagcagcg ctgcgcgtgt gggacgtcgc cgagccttac       360
     acgcaggccg acttcgcgcg ccatgtcggc gaggaagtgc gcatcttcgc cggcagcctg       420
     accacgccgt attgcggcgc gaataccggt ttcgaagcgg cgcagtggct ggcgccgtcc       480
     ggcgcatccg gcggcgacga gagcgcggcc ggccaggcgg ggcccgagtc ggcgcacgcc       540
     accgagtcga tcgccctgct cgcgctgcgc gaccctgaag gcaacgaaga agccccgact       600
     ttcggcctgc tggtgatggg ctcgcccgac gcgcgccgct ttcacgaagg catggcaacg       660
     gatttcctca cccagatcgg cgcgctggca agcgccgcgc tgagccgtct gctgccgcgc       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page