(data stored in ACNUC7421 zone)

EMBL: CP000270.PE92

CP000270.PE92        Location/Qualifiers
FT   CDS_pept        complement(110251..110661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4370"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28630"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V9"
FT                   /protein_id="ABE28630.1"
FT                   /translation="MAHTPSRDTLPTSEAMHTLLSTPLTRAALKAARPARRHVVRALRH
FT                   HATRTRALGEQWRDAKAVDGIRTWFNTFFSALRLQGSSRRFSLRTLLRKPTPLRLAAPR
FT                   AAVAVPQNSSRRPRRMSTNGSTGWFAFAFASR"
     atggcgcaca ctccgtcgcg cgacacgttg cctaccagtg aagccatgca tactctcctg        60
     agcacccctc tcacccgcgc cgcactgaaa gcggcgcgtc cggcgcgtcg ccacgtcgtg       120
     cgcgcgctgc gtcaccatgc cacacgcact cgcgcgctgg gcgaacaatg gcgcgacgcc       180
     aaagctgtcg acggcattcg cacctggttc aatacgttct tctccgcgct gcgcctgcaa       240
     ggcagttcgc gccgtttctc gctgcgcacg ctgctgcgca aacccacgcc gttgcgtctc       300
     gccgcgccgc gcgcagcggt cgccgtgccg cagaattcga gccgccgtcc gcgtcgcatg       360
     tcgacgaacg gcagcaccgg ctggttcgcg ttcgcgtttg cgagccgtta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page