(data stored in ACNUC7421 zone)

EMBL: CP000270.PE93

CP000270.PE93        Location/Qualifiers
FT   CDS_pept        111078..111839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4369"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28631"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V8"
FT                   /protein_id="ABE28631.1"
FT                   /translation="MSLHSKKEQIQTLREQGFVVVPGLVSAGRCEELKQIAQRQLEEAA
FT                   APIEFEADLQYPGAPESRQAAGGHTVRRLLDAYARHPGFARWATAPEIRGWMELYFGEE
FT                   PRLSRAHHNCMMTKHPAYGSLTGWHRDVRYWSFERDDLVSVWLALGSETVDNGALWMVP
FT                   KSHSAAFTSDRFDQAKFFRSDLEENQEWIRTAVSPELKAGDVVFFHCNTLHSAGKNITD
FT                   QVKFSLVYTYHGASNVPLPGTRSAAKPEVAF"
     atgtcacttc attccaagaa agagcagatt caaacgttgc gggagcaggg ttttgtcgtg        60
     gtgcccggat tggtgtcggc cgggcgttgc gaagaactga aacagatcgc gcagcgccag       120
     ctggaagagg cagccgcgcc gatcgagttc gaagcggatc tgcaatatcc cggcgcgccg       180
     gagtccaggc aggcagccgg cggccatacg gtgcggcggc tactggacgc gtacgcacgt       240
     catccgggtt ttgcgcgctg ggcgaccgcg ccggaaattc gcggctggat ggagttgtat       300
     ttcggtgaag agccgcgcct gtcgcgcgcg caccataact gcatgatgac caagcatcct       360
     gcgtacggca gtttgactgg ctggcatcgc gacgtgcggt attggtcgtt cgagcgcgac       420
     gatctggttt cggtgtggct cgcgctcggt tcggagacgg tggataacgg cgcgctgtgg       480
     atggtgccga agtcgcacag cgccgcgttt acatccgacc ggttcgatca ggccaaattc       540
     ttccgctccg atctggaaga gaatcaggaa tggattcgta ctgcggtgtc acctgagctc       600
     aaggccggcg acgtggtgtt tttccattgc aatacgctgc attcagccgg caagaacatc       660
     accgatcagg tgaagttttc actggtgtac acgtatcacg gcgcgagcaa cgtgccgttg       720
     ccgggaaccc gctcggccgc gaagcccgag gtggcgttct ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page