(data stored in ACNUC7421 zone)

EMBL: CP000270.PE99

CP000270.PE99        Location/Qualifiers
FT   CDS_pept        complement(116909..118312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4363"
FT                   /product="RND efflux pump, membrane fusion protein, CzcB
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28637"
FT                   /db_xref="GOA:Q146V2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V2"
FT                   /protein_id="ABE28637.1"
FT                   /translation="MEGQRPDSSGTTRDPAKTKRARWIAVAVAVAVIALAAQGIWSRHD
FT                   AHAALERDAEHASQTSVEVVRPQKSTAGLDLVLPGNVQAFLDTPIYARTNGYLKKWYAD
FT                   IGAKVKNGQLLAEIDTPEVDDQLRAARADLANAEANYALAKSTAARWTEMLKSKSVSKQ
FT                   ETDEKVGDMLAKKATLDAARFNVARLEKTQSFQKVYAPFDGIVTARNVDVGALIDAGSS
FT                   GGPAKELFHVAQADRLRVYVNVPQAYAQQVRARQTAFLTLTETPSRHYPGTVARTAGAV
FT                   DPQQRTMLVEVDVDNRNGDLLPGAYAQVHFELGTGAAPFTLPGNALLFRPDGVKLATVD
FT                   AQHKVKLIAVSLGTDFGTRVAIASGLQGDEQVILNPQDSIIDGAPVRIVAAKAGTATGA
FT                   SGATGASGSAAGGEGTAGASGAAASRDGAASASGAAAGNDRAAGGSNAVAADTPTTHVA
FT                   ASLSVKASS"
     atggaaggac aacgtccaga cagctccggc accacgcgcg atccggcgaa gacaaagcgc        60
     gcacgctgga tcgccgtcgc ggtcgccgtg gcggtcattg cgctcgcggc acaaggtatc       120
     tggtcgcgtc acgacgcgca tgcggcgctc gaacgcgatg ccgagcacgc cagccagacg       180
     agcgtcgaag tcgtgcggcc gcagaaatcg acggccggac tcgatctcgt gctgcccggc       240
     aacgtacagg cgtttctcga cacgccgatt tacgcccgca ccaacggcta tttgaagaag       300
     tggtacgcgg atatcggcgc gaaggtgaaa aacggtcagt tgctggcgga gatcgacacg       360
     ccggaagtgg acgatcaact gcgcgcggcc cgcgccgatc tcgcgaatgc cgaggccaac       420
     tatgcgctcg cgaaaagcac cgccgcgcgc tggaccgaga tgctgaaaag caaatcggtc       480
     tcgaagcagg aaaccgacga aaaggtcggc gacatgctcg caaagaaagc cacgctcgac       540
     gccgcgcgct tcaacgtggc gcgactcgag aaaacgcagt cgttccagaa agtgtatgcg       600
     ccgttcgacg gcatcgtgac ggcgcgcaat gtcgatgtcg gcgcgctgat cgacgcgggc       660
     agttcgggcg gcccggcaaa ggagctgttt cacgtcgcgc aggcggatcg gctgcgcgtt       720
     tatgtgaacg tgccgcaggc ctacgcgcag caggttcgcg cgcggcagac cgcgttcctg       780
     acgctgaccg agacgccgtc gcgacattat ccgggcaccg tggcgcgcac cgcgggcgcc       840
     gtcgatccgc aacagcgcac gatgctggtg gaagtcgacg tcgacaaccg taacggcgat       900
     ttgctgccgg gcgcgtatgc gcaagtgcac ttcgaattgg gcacaggcgc ggcgccgttc       960
     acgctgcccg gtaacgcgct gctgttccgc ccggatggcg tgaaactcgc gaccgtcgac      1020
     gcgcagcaca aggtgaagct gatcgcggtg tcgctgggaa cggacttcgg cacgcgtgtc      1080
     gcgattgcgt ccggcctgca gggcgatgag caggtgatcc tgaatccgca ggactcgatc      1140
     atcgacggcg cgccggtgcg gatcgtggcg gcgaaagcgg gaactgccac gggcgcgtca      1200
     ggagcgaccg gtgcttccgg ctcggcggcg ggtggtgagg gcacggcggg cgcatccggc      1260
     gccgcggcga gccgcgatgg tgcggcaagc gccagcggcg cagccgcggg caatgatcgg      1320
     gcggcgggcg gctccaacgc tgttgcggca gacacgccca ccacgcatgt cgccgcgtcg      1380
     ctgtccgtaa aggcatcgtc atga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page