(data stored in ACNUC7421 zone)

EMBL: CP000271.FAE

CP000271.FAE         Location/Qualifiers
FT   CDS_pept        complement(691827..692336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fae"
FT                   /locus_tag="Bxe_B2436"
FT                   /product="Formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33555"
FT                   /db_xref="GOA:Q13QT4"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT4"
FT                   /protein_id="ABE33555.1"
FT                   /translation="MAKINRVLIGESLVGDGNEVAHIDLLIGPRGSAAETAFCNALTNN
FT                   KDGFTSLLAVIAPNLLTKPNTILFNKVTIKGAKQAVQMFGPAQHAVALAVADSVEDGTI
FT                   PKDEADDLFLCVGVFIHWQADDDKKIQEFNYKATREAIQRAVAGEPSAAEVVAKKGSVA
FT                   HPFAPN"
     atggccaaga tcaatcgcgt cctgatagga gagtcgctcg tcggcgacgg caacgaggtc        60
     gcacacatcg acttgctgat cggaccgcgc ggttcggctg cggaaaccgc attctgcaat       120
     gcgctcacca ataataagga tggcttcaca tcgctgctcg ccgtcatcgc gccgaacctc       180
     ctcaccaagc cgaacacgat cctgttcaac aaggtcacca tcaagggcgc caaacaggcg       240
     gtgcagatgt tcggtcccgc gcagcatgcc gtggcgctcg ctgtcgcgga cagcgtcgag       300
     gacggcacga ttccgaaaga cgaggcggac gacctgttcc tgtgcgtcgg cgtcttcatt       360
     cactggcagg cggacgacga caagaagatt caggagttca actacaaggc cacgcgcgag       420
     gcgatccagc gcgctgtcgc cggcgagccg agtgccgcgg aggtggtggc gaaaaagggc       480
     agcgtcgcgc atccgtttgc accgaactga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page