(data stored in ACNUC7421 zone)

EMBL: CP000271.FHCA

CP000271.FHCA        Location/Qualifiers
FT   CDS_pept        complement(664362..666062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcA"
FT                   /locus_tag="Bxe_B2462"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33529"
FT                   /db_xref="GOA:Q13QW0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW0"
FT                   /protein_id="ABE33529.1"
FT                   /translation="MSLIRLKGGTLFDPTHGVNGERRDLAIRDGRIVEVPAATPADHEY
FT                   DATGMIVMAGGIDMHSHIGGGKTNLSRLLLPEDHRDDRVRDAAYESVQDANGRYLRLPS
FT                   CGVCTPGTLATGYRYAEMGYTAAFEPAMMPSNARHTHLEMGDTPIIDHGAYVMLGNDEL
FT                   FLQMLAARDDFERLRDYIGWTIHASKALGVKVVNPGGISAFKFNQRSLNVDEPHVHYGI
FT                   TPREVLHTLSRALTELRVPHPLHVHASNLGVPGNIDSTIATMDAAGGLPIHLTHIQFHS
FT                   YGTEGPQKFSSGARQIAEAVNARPNVSIDVGQIIFGQTVTASGDTMMQFRNTPLARPHK
FT                   WVIGDIECDAGCGVVPFRYREQSYVNALQWIIGLEIFLLIDDPWRVAMTTDHPNGGPFT
FT                   SYPHLIRLLMDKSFRDEQLAKLNADAQVASALPQLQREFSLYEIAIITRAGPARLLGLR
FT                   DRGHLGVGAAADIAVYRDDADRERMFTSPAYVFKDGELVARDGTLVATPTGGIHFVSPD
FT                   FDRGIEKTLRAYSDANLANNFAHAAIGDDEICHCCRGGRLLPVECLSNG"
     atgagtctga tccggctcaa gggcggcacg ctcttcgatc ccacccacgg cgtgaacggc        60
     gagcgccgcg acctggcgat ccgcgacggc cgcattgtcg aggtgcccgc cgccacgccg       120
     gccgaccacg aatacgacgc caccggcatg atcgtgatgg caggcggcat cgacatgcac       180
     tcgcatatcg gcggcggcaa gaccaatctt tcgcgcctgc tgctgcccga ggatcatcgc       240
     gacgaccgtg tgcgggacgc cgcctatgaa tcggtgcagg acgcgaacgg ccgctacctg       300
     cggctgccgt cgtgcggcgt ctgcacgccc ggcacgctcg caaccggcta ccgctacgcc       360
     gaaatgggct acacggccgc gttcgagccg gccatgatgc cgtccaacgc gcgccacacg       420
     cacctcgaaa tgggcgacac gccgatcatc gatcacggcg cgtatgtgat gctcggcaac       480
     gacgagctgt tcctccagat gctcgccgcg cgcgacgact tcgagcggct gcgcgactac       540
     atcggctgga cgattcatgc gagcaaggcg ctcggcgtga aggttgtcaa tccgggcggc       600
     atctccgcgt tcaagttcaa ccagcgctcg ctgaacgtgg acgagccgca cgtgcattac       660
     ggcatcacgc cgcgcgaggt gctgcacacc ctctcgcgcg cgttgaccga gttgcgcgtg       720
     ccgcatccgc tgcatgtgca tgcgagcaat ctcggcgtgc ccggcaacat cgattcgacg       780
     atcgccacga tggatgccgc cggcggcctg ccgatccatc tcacgcatat ccagtttcat       840
     agctacggca ccgagggtcc gcaaaagttt tcgtcgggcg cgcggcagat cgcggaagcg       900
     gtgaacgcac ggccgaacgt gtcgatcgac gtcggacaga tcatcttcgg gcagaccgtc       960
     accgcatcgg gtgacaccat gatgcagttc cgcaacacgc cgctcgcgcg tccgcacaaa      1020
     tgggtgatcg gcgatatcga atgcgacgcg ggctgcggcg tggtgccgtt ccgctatcgc      1080
     gagcagagct atgtgaatgc gttgcagtgg atcatcggcc tcgagatctt tctgctgatc      1140
     gacgacccgt ggcgcgtcgc gatgaccacc gatcatccga acggcggccc attcacgagc      1200
     tatccgcatc tgatccgcct gctgatggac aaatcgtttc gcgacgagca actcgcgaag      1260
     ctcaatgccg acgcacaggt ggcgagcgcg ttgccgcagt tgcaacgcga gttctcgctg      1320
     tacgaaatcg ccatcatcac gcgcgccggc ccggcacgcc tgctcgggtt gcgcgaccgg      1380
     ggccatctgg gcgtcggcgc ggcggcggac attgccgtct atcgcgacga cgcggaccgc      1440
     gagcggatgt ttacgtcgcc cgcgtatgtg ttcaaggacg gcgaactggt cgcgcgcgac      1500
     ggcacgctcg tcgccacgcc cacgggcggc atccatttcg tttcgcccga cttcgaccgg      1560
     ggcatcgaga agacgttgcg cgcctacagc gacgccaatc tggcgaacaa cttcgcgcat      1620
     gccgccatcg gcgacgacga gatctgccac tgctgccgcg gcggcagact gctgccggtc      1680
     gaatgtctct cgaacggctg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page