(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF19

CP000271.ORF19       Location/Qualifiers
FT   CDS_pept        complement(672255..672854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf19"
FT                   /locus_tag="Bxe_B2455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33536"
FT                   /db_xref="GOA:Q13QV3"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV3"
FT                   /protein_id="ABE33536.1"
FT                   /translation="MIHETIVTTAACDGRPHIAPMGARYEGDFVILSPFRPSVTLDNIV
FT                   ASRAAVLNFTTDVRIFAGCVTHCATDWPTLAASRVASVRLAESLAHAELELDDLRDDKE
FT                   RPVLRMKCVHRENHAPFGGFNRAQAAVVEGAILVSRLFMLPADKVDREMAYLQIAIDKT
FT                   AGEAELTAWHWLTAAIARHRENLAASGGPAAELVSH"
     atgatccacg aaacgatcgt caccacggca gcgtgcgatg gccgtcctca tatcgcgccg        60
     atgggagccc gttacgaggg cgacttcgtc atcctctcgc cttttcgtcc gtccgtgacg       120
     ctcgacaata tcgtggcgtc gcgcgcagcg gtgctgaact tcaccacgga cgttcgtatc       180
     tttgccggct gcgtcacgca ttgcgcaacc gattggccca cgctcgcggc gagccgcgtg       240
     gcgagcgtca ggctcgccga atcgctcgcg catgcggaac tcgaactcga cgacctgcgc       300
     gacgacaagg agcgtccggt gctgcgcatg aaatgcgtgc accgcgaaaa ccatgcgccg       360
     ttcggcggct ttaaccgcgc ccaggcggcc gtggtggaag gcgcgattct cgtcagccgg       420
     cttttcatgc tgcctgccga caaggtggac cgggaaatgg cctacctgca gatcgccatc       480
     gacaaaaccg cgggcgaggc cgaactcacc gcctggcact ggctcaccgc cgcgatcgcg       540
     cggcaccgcg agaatctcgc cgcgtccggc ggcccggccg ccgaactcgt gtcccactag       600
//

If you have problems or comments...

PBIL Back to PBIL home page